DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina1f

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:444 Identity:92/444 - (20%)
Similarity:182/444 - (40%) Gaps:78/444 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IALAGLCGVEPDAGLLDQRLNLYKGQ--------------QNFAVSMLNVIRQSTPNENVFFSPY 65
            :.|.|||.:.|......:  :||:..              .|.::::...:.|.:.|.|:.|||.
  Rat    11 LLLVGLCCLLPITKTKYE--DLYEDPNIDPFQCRKVALTISNISITLFKEMAQLSVNGNILFSPI 73

  Fly    66 STYHALLLAYFGSSGDTEKELAKVLHLD-----WADSKEVVRSAYILEKMNRKERQSKMPLEFSS 125
            ....|:.:...|:.|:..|.:.::|.|:     .|:..:..|  |:|..:::.|:.|  ||:  |
  Rat    74 RVIAAISMLSLGAKGNESKRILEILRLNKTGLPEAEIHKCFR--YLLRAIHQPEQLS--PLK--S 132

  Fly   126 ADRIFFANDL----HVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEI 186
            ...:|...||    ...|..:|....::..|:| :....::.|||:::..:::.:|:|::.  .:
  Rat   133 GSGVFIHQDLTPVDKFVEGVKNLYHSDIVSINF-TDCRRAKTQINNYMMTKSNKEIKNIVK--NL 194

  Fly   187 TPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVD-------EQ 244
            ...|.:.:.|......:..|.|....       ....:|.|...|..|...:..||       |.
  Rat   195 ENDTYMAVVNYIIWNAKINSDFGCRS-------VKQKDYHLEQGMTIKVPMIHIVDLNHLFRVED 252

  Fly   245 LRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMP 309
            |.:.||      ||....         |:.:...|:|  :...::.|..||.........:|:..
  Rat   253 LSSTVL------VFTLLA---------SNFTTYFIIP--DIGQMQKVEQRLTYPHFRRMRRQSNL 300

  Fly   310 REIEVSLPKFEFEQRLELNPILAKMGVSKMFD---ESVATFDDLTSETISIGDSKHVAKIK--VD 369
            |.:.:..|:....:..::..::..:|::.:|:   .|.|..:|...::.     |.|:|:|  :|
  Rat   301 RMVNLETPELSLSETHDVESMMNLLGITYVFNNDANSSAVMNDTLQKSF-----KMVSKVKLTID 360

  Fly   370 EEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
            ::||....:|   .:::...|:....:.|.|||..|.|.|:...||.|...:||
  Rat   361 DKGSKPGRST---CFKNDGSVDVGYVQFNRPFLIFIKDPTNDVPLFLGRVVNPK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 83/414 (20%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 83/403 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.