DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and RGD1562844

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:289 Identity:90/289 - (31%)
Similarity:141/289 - (48%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ILEKMNRKERQSKMPLEFSSADRIFFANDLHV-----TECAR--NRLAEEVQQIDFKSQTEESRK 163
            :.:|:|:.||...:.:    |:.||......|     ..|.|  |   .|::|:.|....|||||
  Rat    23 LFKKLNKSERYFSLRM----ANGIFVDKTCEVLPTFKESCLRFYN---SEMEQLSFAEAAEESRK 80

  Fly   164 QINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLV 228
            .:|.|::|||..:|..:|..|.:..:|||||.||.|||..|..||....|..|||..:.:....|
  Rat    81 HVNTWVSKQTEGKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNETRPV 145

  Fly   229 SMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDS------SPDENSDISMVLILPPFNSNS 287
            .||.|:|.|.....:::.|.:|.:||        |.|.      .|||:.|||.|          
  Rat   146 QMMYQEGIFCYKYVKEVPASLLMIPY--------KGDELCFLVLLPDESVDISKV---------- 192

  Fly   288 LEDVLS--RLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDL 350
             |:.|:  :|.|.:..|::...   .:||.||||:.|:..:|..:|.::|:...|:|:.|....:
  Rat   193 -EEELTFEKLTAWTQPDTMSYT---HVEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAM 253

  Fly   351 TSE-TISIGDSKHVAKIKVDEEGSTAAAA 378
            ..| .:.:....|.:.::|:|:|:.||||
  Rat   254 APERNLCVSKFVHKSVVEVNEKGTEAAAA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 90/289 (31%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.