DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb9d

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:361 Identity:100/361 - (27%)
Similarity:173/361 - (47%) Gaps:35/361 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LAYFGSSGDTEKELAKVLHLDWADSKEVVRS-AYILEKMNRKERQSKMPLEFSSADRIFFANDLH 136
            :...|:.|||..::::.|:|:....:::.:. ..:|..:|:.:....:.:    |:|:|..|...
  Rat     1 MVLLGAKGDTAVQISQALNLNKHPDEDIHKDFQLLLHNLNKPKSHYCLRI----ANRLFAENTCK 61

  Fly   137 VT-----ECAR--NRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVL 194
            :.     .|.|  |   .|::|:.|....|||||.||.|::|||..:|..:||:|.:...|:|::
  Rat    62 LVPTYKESCLRFYN---SEIEQLSFAKAAEESRKHINTWVSKQTEGKIPELLSSDSVGSETKLIM 123

  Fly   195 ANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFE 259
            .||.|.:|.||..|..|.|:.|||..:......|.||.|:.||.:...::::|.:|.:|||    
  Rat   124 VNALYFQGSWLHCFDKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQILVMPYR---- 184

  Fly   260 SQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAM--PREIEVSLPKFEFE 322
                       ..::|.:::||. ....:..|.|.|..:.|....|...  ..|:.|.||||:.:
  Rat   185 -----------GMEMSFMVLLPD-EGVDIRKVESSLTFEKLTAWTKPEFIYSTEVYVYLPKFQLQ 237

  Fly   323 QRLELNPILAKMGVSKMFDESVATFDDLTSE-TISIGDSKHVAKIKVDEEGSTAAAATVLFTYRS 386
            ::.::..:...:|:..:|.|..|....:..| .:.:....|...::|:|||:.||||:......|
  Rat   238 EQYDMTALFQHLGMIDVFSEIKADLSGMCPEKDLCVSKFVHECVVEVNEEGTEAAAASAADCCYS 302

  Fly   387 ARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            .....|. |..:.||||.|....:.||||.|.:..|
  Rat   303 CSEYTPT-FCADRPFLFFIRHNQTNSILFCGRFSSP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 99/356 (28%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 99/359 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.