DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPIND1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:416 Identity:115/416 - (27%)
Similarity:185/416 - (44%) Gaps:68/416 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QRLNLYKGQQNFAVSMLNVIR-QSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHL-DW 94
            ||||:...:  ||.::..|:: |....:|:|.:|.....|:.:...|..|:|.:::..:||. |:
Human   124 QRLNILNAK--FAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDF 186

  Fly    95 --ADSKEVVRS-----------------AYILEKMNRKERQSKMP--LEFSSADR-IFFANDLHV 137
              |.||..:.:                 .|.|..:|....|.:.|  |:|.:..| .:||     
Human   187 VNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFA----- 246

  Fly   138 TECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKG 202
                      |.|..||......|:  .|:.|.|.|...|::.|  :.|.|.|::::.|..|.||
Human   247 ----------EAQIADFSDPAFISK--TNNHIMKLTKGLIKDAL--ENIDPATQMMILNCIYFKG 297

  Fly   203 QWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSS 267
            .|:::|..|.|....|..:......|||||.||.||...|::|...:|||.|             
Human   298 SWVNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEY------------- 349

  Fly   268 PDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILA 332
               ...||| ||:.|...:.::.:.::|....::...|....|..||.||||:.|:...|...|.
Human   350 ---VGGISM-LIVVPHKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLK 410

  Fly   333 KMGVSKMFDESVATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVL-FTYRSARPVEPAKFE 396
            .||:..:||:: .....::.:.|:|...||...|.|:|||:.|...|.: |...|.:    .:|.
Human   411 LMGIRMLFDKN-GNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQ----VRFT 470

  Fly   397 CNHPFLFVIYDRTSRSILFTGIYRDP 422
            .:.||||:||:..:..:||.|...:|
Human   471 VDRPFLFLIYEHRTSCLLFMGRVANP 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 110/404 (27%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 115/416 (28%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.