DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb13

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001100638.1 Gene:Serpinb13 / 304690 RGDID:1304661 Length:389 Species:Rattus norvegicus


Alignment Length:404 Identity:118/404 - (29%)
Similarity:190/404 - (47%) Gaps:72/404 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDW--------ADSKEVVRSAYILEKMN 111
            |.:.||||||.....|:.:...|:.|.|..||.|||:.:.        ::.||:       ||..
  Rat    22 TSDGNVFFSPLGISTAIGMILLGTQGATASELQKVLYSEQGTGSSRLKSEEKEI-------EKTE 79

  Fly   112 RKERQ-SKMPLEFSSADRIFFANDLHVTECARNRLAEE--------------------VQQIDFK 155
            ....| .|:..|.|...:.:   ||.::    |||..|                    ::.:||.
  Rat    80 EIHHQFQKLLTEISKPTKDY---DLIIS----NRLYGERTYLFLQKYIDYVEKYYHASLEPVDFV 137

  Fly   156 SQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYT 220
            :..:||||:||.|:..||:::::::.....:...|:|||.|..|.||.|..:||.|.|....|:.
  Rat   138 NAADESRKKINSWVESQTNEKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDFWL 202

  Fly   221 SPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNS 285
            :.:....|.||.|..:|...:.|.|:|.::.:||:               |||.||.::||. :.
  Rat   203 NKNISKPVQMMAQCSSFSFTLLEDLQAKIVGIPYK---------------NSDFSMFVLLPN-DI 251

  Fly   286 NSLEDVLSRLNADSLDD-----SLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVA 345
            :.||.::.:|:.:.|.:     .|||   |::::.||:.:.|:..:|.|.|..:|:...|.|. |
  Rat   252 DGLEKIIDKLSPEKLVEWTSPGQLKQ---RKVDLRLPRLKVEETYDLQPTLEAVGIHSAFSEH-A 312

  Fly   346 TFDDLTSET-ISIGDSKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDR 408
            .:..:::.: :...:..|.:.:.|.|||..|.|.| |.|...||...|  ...|||||||.:..|
  Rat   313 DYSGMSAHSGLQTQNFLHRSFLVVTEEGVEATAGTGVGFKVLSAASCE--LVHCNHPFLFFVRHR 375

  Fly   409 TSRSILFTGIYRDP 422
            .|.||||.|.:..|
  Rat   376 ESDSILFFGRFSSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 117/399 (29%)
Serpinb13NP_001100638.1 SERPIN 4..389 CDD:294093 117/402 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.