DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb3

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001382662.1 Gene:Serpinb3 / 304688 RGDID:1549766 Length:387 Species:Rattus norvegicus


Alignment Length:410 Identity:111/410 - (27%)
Similarity:195/410 - (47%) Gaps:53/410 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVR 102
            |....|.:.:...:|.|  .:|:|:||.|...||.:...|:.|:|||::.|.|.|.....|...:
  Rat     6 KATTQFTLELYRQLRDS--EDNIFYSPLSIMTALAMLQLGAKGNTEKQIEKALQLSETTKKPKEK 68

  Fly   103 SAYILEKMNRKER---------QSKMPLEFSSADRIF----------FANDLHVTECARNRLAEE 148
            ||...::.|..|:         :|....:..|.:.|:          |..|:      :......
  Rat    69 SADSHDEENVHEQFRKIMNQLNKSNGAYDLKSPNSIYGAKGFPFLQTFMEDI------KKYYQAN 127

  Fly   149 VQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKT 213
            |:.:||....|||:|:||.|:..:|:.:|:::.....:...|.|||.||.|.||||..:|..::|
  Rat   128 VESLDFAHAAEESQKKINSWVENKTNGKIKDLFPRGSLNSSTILVLVNAVYFKGQWNHKFDEQRT 192

  Fly   214 VPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVL 278
            ....|:.:.:....|.||:|...|.....|.::|.::::||:               ..::||.:
  Rat   193 REDKFWLNKNTSKPVQMMRQTNEFNFIFLEDVQAKMVEIPYK---------------GKELSMFI 242

  Fly   279 ILPPFNSNSLEDVLSRLNADSLDDSLKQAMPR-----EIEVSLPKFEFEQRLELNPILAKMGVSK 338
            :| |...:.|:.:..:|:||:|   |....|:     ::.:|||:|:.:::.:|...|..||:..
  Rat   243 LL-PMEIDGLKKLEEKLSADTL---LAWTSPKNMRMTQLNLSLPRFKVQEKYDLPGPLEHMGMVD 303

  Fly   339 MFDESVATFDDLTS-ETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFL 402
            .|:...|.|..::| :.:.:....|.:.::|:|||:.|||||.:.|...:.| ...:|.||.||:
  Rat   304 AFNPQKADFSGMSSTKGLVVSKVLHKSFLEVNEEGAEAAAATGVETRILSAP-RTTEFTCNRPFI 367

  Fly   403 FVIYDRTSRSILFTGIYRDP 422
            ..|....:.||||.|....|
  Rat   368 VFIKPNNTNSILFFGRVSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 109/404 (27%)
Serpinb3NP_001382662.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.