DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpinh1b

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001296752.1 Gene:serpinh1b / 30449 ZFINID:ZDB-GENE-990415-93 Length:405 Species:Danio rerio


Alignment Length:435 Identity:98/435 - (22%)
Similarity:190/435 - (43%) Gaps:60/435 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLMAV-LPAIALAGLCGVEPDAGLLDQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHA 70
            ||:|: |.|:|::|     .|..|.....::.....|.|.::.:.:.:....||:..||.....:
Zfish     5 SLIALCLLAVAVSG-----EDKKLSTHATSMADTSANLAFNLYHNVAKEKGLENILISPVVVASS 64

  Fly    71 LLLAYFGSSGDTEKELAKVLHLDWADSKEVVR--SAYILEKMNRKERQSKMPLEFSSADRIF--- 130
            |.:...||...|..::..||..|....:.:..  |..:.|..:.:.|.    :.:..::|::   
Zfish    65 LGMVAMGSKSSTASQVKSVLKADALKDEHLHTGLSELLTEVSDPQTRN----VTWKISNRLYGPS 125

  Fly   131 ---FANDLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTR- 191
               ||.|.  .:.::.....|..:|:|:.: ..:...||:|.||.|..::      .|||...: 
Zfish   126 SVSFAEDF--VKNSKKHYNYEHSKINFRDK-RSAINSINEWAAKTTDGKL------PEITKDVKN 181

  Fly   192 ---LVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLP 253
               .::.||.:.|..|..:|..:......|..:.|:...|.||.:.|.:....|.:.|..::.:|
Zfish   182 TDGAMIVNAMFFKPHWDEKFHHKMVDNRGFLVTRSHTVSVPMMHRTGIYGFYEDTENRFLIVSMP 246

  Fly   254 YRTVFESQEKEDSSPDENSDISMVLILP----PFNSNSLEDVLSRLNADSLDDSLKQAMPREIEV 314
            .     :.:|.          ||:.|:|    |.  :.||::|:|...|:....|::   |.:.:
Zfish   247 L-----AHKKS----------SMIFIMPYHVEPL--DRLENLLTRQQLDTWISKLEE---RAVAI 291

  Fly   315 SLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVAKIKVDEEGSTAAAA 378
            ||||...|...:|...|.::|:::..|:|.|...::: .:.:.:.:..|.:.::.|.||:....:
Zfish   292 SLPKVSMEVSHDLQKHLGELGLTEAVDKSKADLSNISGKKDLYLSNVFHASSLEWDTEGNPFDPS 356

  Fly   379 TVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
                .:.|.:...|..|..:|||:|::.|..:.||||.|....||
Zfish   357 ----IFGSEKMRNPKLFYADHPFIFLVKDNKTNSILFIGRLVRPK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 87/396 (22%)
serpinh1bNP_001296752.1 hsp47 28..393 CDD:239001 87/401 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.