DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and LOC299282

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:436 Identity:118/436 - (27%)
Similarity:195/436 - (44%) Gaps:45/436 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSISLMAVLPAIALAGLCGVE----PDAGLLDQ--RLNLYKGQQNFAVSMLNVIRQSTPNENVFF 62
            |.:.:..:.||:...|..|.:    .|.|...|  .|.|.....:||:|:...:....|::||.|
  Rat     7 LGLLMAGICPAVLCDGTLGRDTLSHEDHGKGRQLHSLTLASSNTDFALSLYKKLALRNPDKNVVF 71

  Fly    63 SPYSTYHALLLAYFGSSGDTEKELAKVLHLDWAD-SKEVVRSAY--ILEKMNRKERQSKMPLEFS 124
            ||.|...||.:...|:...|.:|:.:.|..:..: ::|.:...:  :|:::::.|.|    :|.:
  Rat    72 SPLSISAALTILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGFGHLLQRLSQPEDQ----VEIN 132

  Fly   125 SADRIFFANDLHV----TECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADE 185
            :...:|...:..:    .|..|.....|....||| |..|::|.|||:::.||..:|..:.|  :
  Rat   133 TGSALFIDKEQPILSEFQEKTRALYQAEAFIADFK-QPNEAKKLINDYVSNQTQGKIAELFS--D 194

  Fly   186 ITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNV-DEQLRAHV 249
            :..||.:||.|....||:|...|....|....||........|.||:.|......| ||:|...|
  Rat   195 LEERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVKVPMMKIKEVTTPYVRDEELSCSV 259

  Fly   250 LQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREI-E 313
            |:|.|                ..:.|.:.|||  :...::.|.|.|..::|.......:||.| :
  Rat   260 LELKY----------------TGNASALFILP--DQGKMQQVESSLQPETLKKWKDSLIPRIIND 306

  Fly   314 VSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVAKIKVDEEGSTAAA 377
            :.:|||.......|..:|.::|:.|:|.:. |....:| ::.:.:....|.|.:.|||.|:.|.|
  Rat   307 LRMPKFSISTDYSLKEVLPELGIKKVFSQQ-ADLSRITGTKDLYVSQVVHKAVLDVDETGTEATA 370

  Fly   378 ATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
            ||.:.|....   :|.....|.||:.||.|..|:||||.....:||
  Rat   371 ATGVATVIRR---QPRTLNFNRPFMVVITDMDSQSILFVAKITNPK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 106/389 (27%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 109/405 (27%)
RCL 365..389 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.