DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina16

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:468 Identity:111/468 - (23%)
Similarity:170/468 - (36%) Gaps:106/468 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHILSISLMAVLPAIALAGL--CGVEPDAGLLDQRLNL-----------YKGQQNFAVSMLNVIR 52
            :.|||:.|:       ||||  |..:|......:..|:           :...|.||:|:...:.
  Rat     3 LSILSLWLL-------LAGLVPCSCDPQTPPPPEASNMSQIPVTQGAPPFFNNQKFALSLYKQLP 60

  Fly    53 QSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMNRKERQS 117
            |....:|:.|||......|:|..|       ::..|..|....|....|..|.          .:
  Rat    61 QPKRGKNLIFSPLGIIVPLVLLAF-------QDKPKARHQVLQDLGFTVTGAL----------DT 108

  Fly   118 KMPLEFSSADRIFFANDLHVTEC-----------------------ARNRLAEEVQQIDFKSQTE 159
            |...|:..    ..:|.||...|                       |.:.....|..|.| ....
  Rat   109 KAASEYGK----LLSNLLHTKNCGIYTGSLLFIDKTLKPAKTFVKLANSSYNSNVVLISF-GNYG 168

  Fly   160 ESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224
            .::|||:..|..:||.:|..:|..  :.|.|.|.|||..:.||:|...|..:.|....|:.....
  Rat   169 LAQKQIDLAIRARTHGKITKLLRI--LKPPTNLFLANYNFFKGKWKYPFNRKHTRMRYFWLEDGT 231

  Fly   225 YSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLE 289
            .:||.|||:.|.|.|....|:.::|||||:                ...||.|..||  :....|
  Rat   232 KTLVPMMQRVGWFQLQYFSQMHSYVLQLPF----------------TCSISGVFFLP--DDGKFE 278

  Fly   290 DVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSET 354
            :....|...|.:..::.....:..:..|||.....|.|..:.......|:|.|.:    ||:..|
  Rat   279 ESEKALLEQSFETWIQPFPMSKRWLFFPKFSIPVALHLENLKHVNSNIKLFSEHM----DLSRIT 339

  Fly   355 -----ISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEP--AKFECNHPFLFVIYDRTSRS 412
                 :::..:.|..::.|:|:|..          :.....||  |....|..||.:|.|.||.|
  Rat   340 LQKAPLTVSTAVHRVELTVNEDGEE----------KDESQPEPDLATLHFNRSFLLLILDETSNS 394

  Fly   413 ILFTGIYRDPKTI 425
            :||.|...:|..|
  Rat   395 LLFMGKVVNPTRI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 98/409 (24%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 99/421 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.