DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina6

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:435 Identity:96/435 - (22%)
Similarity:181/435 - (41%) Gaps:72/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSISLMAVLPAIALAGLCGVEPDAGLLDQRLNLYKG----QQNFAVSMLNVIRQSTPNENVFFSP 64
            :|::|...|..:..:||...:...   ::..|.::|    ..:||.::...:....|::|...||
  Rat     1 MSLALYTCLLWLCTSGLWTAQAST---NESSNSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISP 62

  Fly    65 YSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRI 129
            .|...||.:...||: .|:...:...:|......|:.:|   .:.:|...:||...||.:..:.:
  Rat    63 VSISMALAMVSLGSA-QTQSLQSLGFNLTETSEAEIHQS---FQYLNYLLKQSDTGLEMNMGNAM 123

  Fly   130 FFANDLHVTEC----ARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRT 190
            |....|.:.:.    .:.....|...|||:..|:.| :|||..:..:|..:|.::.|  ::....
  Rat   124 FLLQKLKLKDSFLADVKQYYESEALAIDFEDWTKAS-QQINQHVKDKTQGKIEHVFS--DLDSPA 185

  Fly   191 RLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPY- 254
            ..:|.|..:|:|.|...|..|.|....||.:.::...|.||.|.|:.....|......::|:.| 
  Rat   186 SFILVNYIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYV 250

  Fly   255 --RTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLP 317
              .|.|                   .|||  :...::.|::.|:.|::|...|...||::.:.:|
  Rat   251 GNGTAF-------------------FILP--DQGQMDTVIAALSRDTIDRWGKLMTPRQVNLYIP 294

  Fly   318 KFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSK---------HVAKIKVDEEGS 373
            ||......:|..:|..:.:.          |.||:::...|::|         |.|.:::||   
  Rat   295 KFSISDTYDLKDMLEDLNIK----------DLLTNQSDFSGNTKDVPLTLTMVHKAMLQLDE--- 346

  Fly   374 TAAAATVLFTYRSARPV----EPAKFECNHPFLFVIYDRTSRSIL 414
                ..||....:..|:    ||...:.|.||:.:::|:.:.|.|
  Rat   347 ----GNVLPNSTNGAPLHLRSEPLDIKFNKPFILLLFDKFTWSSL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 90/400 (23%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 89/396 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.