DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serping1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:428 Identity:103/428 - (24%)
Similarity:185/428 - (43%) Gaps:75/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LCGVEPDAGLLD-----QRLNLYKGQQNFAVSMLNVIRQSTPNE-NVFFSPYSTYHALLLAYFGS 78
            || .||.|...|     ....|.:...:|:|.:.:....:...| |:.|||:|....|.....|:
  Rat   127 LC-PEPLAWCSDSDRDSSEATLSEALTDFSVKLYHAFSATKKAETNMAFSPFSIASLLTQVLLGA 190

  Fly    79 SGDTEKELAKVLHL--DWADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECA 141
            ...|:..|..:|..  |:|...:.:           |...||   ..:|..:||.:.||.:.:..
  Rat   191 GDSTKSNLEDILSYPKDFACVHQTL-----------KAFSSK---GVTSVSQIFHSPDLAIRDTY 241

  Fly   142 RN---RLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQ 203
            .|   .|.....:: .....:.:.|.||.|:|:.|:.:|..:|  |.:...|||||.||.||..:
  Rat   242 VNASLSLYGSSPRV-LGPDGDANLKLINTWVAENTNHKINELL--DSLPSDTRLVLLNAVYLSAK 303

  Fly   204 WLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSP 268
            |...|:.:|.:....|.: |...:..:..:|....|..|:.|:|.|.||..              
  Rat   304 WKKTFEQKKMMASFLYKN-SMIKVPMLSSKKYPLALFNDQTLKAKVGQLQL-------------- 353

  Fly   269 DENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVS--------LPKFEFEQRL 325
              :.::|.|:::|...::.|||:...||     .::.:|:.:::|:|        :|:.:.:...
  Rat   354 --SHNLSFVIMVPQSPTHQLEDMEKALN-----PTVFKAILKKLELSKFQPTYVMMPRIKVKSSQ 411

  Fly   326 ELNPILAKMGVSKMFDESVATFD----DLTSE-TISIGDSKHVAKIKVDEEGSTAAAATVLFTYR 385
            ::..|:.|:   :.||   .|:|    .||.: .:.:...||...:::.|.|..||||:.:...|
  Rat   412 DMLSIMEKL---EFFD---FTYDLNLCGLTEDPDLQVSSMKHETVLELTETGVEAAAASTISVAR 470

  Fly   386 SARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
            :.     ..||...||||:::|:..:..:|.|...||:
  Rat   471 NL-----LIFEVQQPFLFLLWDQRHKFPVFMGRVYDPR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 94/398 (24%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132 3/5 (60%)
SERPIN 150..499 CDD:294093 94/398 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.