DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb6e

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:400 Identity:115/400 - (28%)
Similarity:204/400 - (51%) Gaps:38/400 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHL------DW 94
            |.:....||:.:|.|:.:.: ::||||||.|.:.:|.:...|::|.|..:::|||.|      ..
  Rat     4 LLEANATFALKVLRVLGEDS-SKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGG 67

  Fly    95 ADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHV----TECARNRLAEEVQQIDFK 155
            .|..:..:|  :|.::|:.:|:..:    .:::.:|..:...:    .:..|.....|::.:|||
  Rat    68 GDFHQCFQS--LLTEVNKSDRRHML----KTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFK 126

  Fly   156 SQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYT 220
            ...|:||:.||.|:||:|.|.||.:||...:...|:|||.|:.|.||.|...|..|.|..|||..
  Rat   127 GAPEQSRQHINTWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKV 191

  Fly   221 SPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNS 285
            |.:...:|.||..|..|.....|.:...:..|||.               .:.:|:.::||. ..
  Rat   192 SKNEKKIVQMMFNKSNFRTYHVEDISTTLALLPYL---------------GNQLSITIMLPD-EY 240

  Fly   286 NSLEDVLSRLNADSLDD--SLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFD 348
            ..|..|.:::..:.|.:  .|:.....|:|:.||:|:.|:..::..:|.|:|::..|::..|.|.
  Rat   241 VELRTVENQITYEKLIEWTRLENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFS 305

  Fly   349 DLTSET-ISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRS 412
            .::|:. :.:....|.:.::|:|||:.|||.|.:.|..|  |:.|.....:|||||:|.|..:::
  Rat   306 GISSKPGLFLSKVVHKSVVEVNEEGTEAAAPTEIVTMGS--PLSPQCLVADHPFLFLIQDDRNKA 368

  Fly   413 ILFTGIYRDP 422
            |||.|.:..|
  Rat   369 ILFLGRFSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 113/392 (29%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.