DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb8

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:401 Identity:125/401 - (31%)
Similarity:210/401 - (52%) Gaps:41/401 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKE 99
            :|.:...:||:|:|.::.:...:.|:||.|.|...||.:.|.|:.|:|..::::||.|. .|...
  Rat     3 DLCEANGSFAISLLKILGEEDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGLS-GDGDV 66

  Fly   100 VVRSAYILEKMNRKERQSKMPLEFSSADRIF------FANDLHVTECARNRLAEEVQQIDFKSQT 158
            ......:|.::|:...|..:    .||.|:|      |.:..  .|..:......::::.|...|
  Rat    67 HQGFQTLLAEVNKSGTQYLL----KSACRLFGEESCDFLSTF--KESCQKFYQAGIEEMSFVKDT 125

  Fly   159 EESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPS 223
            |..||:||||:.::|..:|..:||...:.|.|:|||.||.|.||:|.:||..:.|..|||.|:..
  Rat   126 EGCRKRINDWVLEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQE 190

  Fly   224 NYSLVSMMQQKGTF-LLNVDEQLRAHVLQLPYRTVFESQEKEDSS----PDENSDISMVLILPPF 283
            ....|.||.:...| :.:||| :.|.||.|||      .|.|.|.    |||:||:::|     .
  Rat   191 EKKTVQMMFKHAKFKMAHVDE-VNAQVLALPY------AEDELSMVVLLPDESSDLTVV-----E 243

  Fly   284 NSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFD 348
            .:.:.|.:.:..|.::|.:|       :::|..|:.:.|:..:|..:|..:|::..|:|:.|.|.
  Rat   244 KALTYEKLRAWTNPETLTES-------KVQVFFPRLKLEESYDLETVLQSLGMTDAFEETKADFS 301

  Fly   349 DLTS-ETISIGDSKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSR 411
            .:|| :.:.:....|...::|:|||:.|||.| |:...||.| :|| :|..:.||||.|:.:.:.
  Rat   302 GMTSKKNVPVSKVAHKCFVEVNEEGTEAAATTAVIRNTRSCR-IEP-RFCADRPFLFFIWHQKTS 364

  Fly   412 SILFTGIYRDP 422
            ||||.|.:..|
  Rat   365 SILFCGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 123/392 (31%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 124/398 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.