DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinf2

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:444 Identity:103/444 - (23%)
Similarity:184/444 - (41%) Gaps:84/444 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPAIAL-----------------AGLCGVEPDAGLLDQRLNLYKGQQNFAVSMLNVIRQSTPNEN 59
            ||.:||                 .|.|...|..   ::...|.:....|...:.:::.|::.:.|
  Rat    44 LPPLALLKLGNQDLGDHATLKRSPGDCKSAPTT---EETRRLSQAMMAFTTDLFSLVAQTSTSSN 105

  Fly    60 VFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMN--------RKERQ 116
            :..||.|...||.....|:...|.:.|.:|||::.......:.| :..:.:|        |...|
  Rat   106 LVLSPLSVALALSHLALGARNQTLENLQRVLHMNMGSCIPHLLS-HFCQNLNPGTIRLAARIYLQ 169

  Fly   117 SKMPLE---FSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIR 178
            ...|::   ...::::|.|..:.:|                 .:.||....||.|:.:.|..:|.
  Rat   170 KGFPIKDDFLEQSEKLFGAKPVKLT-----------------GRQEEDLMNINKWVKEATEGKIE 217

  Fly   179 NMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKG----TFLL 239
            :.||  |:...|.|:|.||.:..|.|.::|....|....|:........|:||..:.    .|||
  Rat   218 DFLS--ELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVAMMHAQSYPLRWFLL 280

  Fly   240 NVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSL-DDS 303
               ||....|...|::                :::|.|:|:|.:...::.:||:.|..|:| ..|
  Rat   281 ---EQPEIQVAHFPFQ----------------NNMSFVVIMPTYFGWNVSEVLANLTWDTLYQPS 326

  Fly   304 LKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSKHVAKIKV 368
            :::   :..:|.|||...||.|:|...|:|:|:..:|..  .....::.:::.:...:|.:.:::
  Rat   327 MRE---KPTKVRLPKLHLEQHLDLVATLSKLGLQDLFQS--PDLRGISDQSLVVSSVQHQSTMEL 386

  Fly   369 DEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            .|.|..|||||.....|    :..:.|..|.||:|.|.:.|....||.|..|:|
  Rat   387 SEAGVEAAAATSTAMTR----MSLSSFFLNRPFIFFIMEETIGIPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 93/395 (24%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 94/398 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.