DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinf1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:426 Identity:96/426 - (22%)
Similarity:168/426 - (39%) Gaps:52/426 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PAIALAGLCGVEPDAGLLDQRLN-LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYF 76
            ||....|...||.|.......:| |.....||...:..:...:....|:..||.|...||.....
  Rat    30 PAPDSTGEPVVEEDDPFFKAPVNKLAAAVSNFGYDLYRLRSGAVSTGNILLSPLSVATALSALSL 94

  Fly    77 GSSGDTEKELAKVLHLDWADSKEVVRSAY--ILEKMNRKERQSKMPLEFSSADRIFFANDLHVTE 139
            |:...||..:.:.|:.|..::.: :.|.|  :|..:...|:      .|.||.||.|...|.|..
  Rat    95 GAEQRTESVIHRALYYDLINNPD-IHSTYKELLASVTAPEK------NFKSASRIVFERKLRVKS 152

  Fly   140 C----------ARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVL 194
            .          .|.|:.....:||.        ::||:|:..|...:|..  |..|:.....::|
  Rat   153 SFVAPLEKSYGTRPRILTGNPRIDL--------QEINNWVQAQMKGKIAR--STREMPSALSILL 207

  Fly   195 ANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQ-KGTFLLNVDEQLRAHVLQLPYRTVF 258
            ...||.||||.::|.:.||....|:........|.||.. |......:|..|...:.|||.    
  Rat   208 LGVAYFKGQWATKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPL---- 268

  Fly   259 ESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQ 323
                        ...:|::..||...:.:|..:...|.::.:.|..::....:..:::||.:...
  Rat   269 ------------TGSMSIIFFLPLTVTQNLTMIEESLTSEFVHDIDRELKTIQAVLTVPKLKLSY 321

  Fly   324 RLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSAR 388
            ..::...|..|.:..:|:.  ..|..:|.:.:.:...:|.|..:.:|||:..::...|...|...
  Rat   322 EGDVTNSLQDMKLQSLFES--PDFSKITGKPVKLTQVEHRAAFEWNEEGAGTSSNPDLQPVRLTF 384

  Fly   389 PVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPKT 424
            |::   :..|.||:||:.|..:.::||.|...||.:
  Rat   385 PLD---YHLNRPFIFVLRDTDTGALLFIGRILDPSS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 86/392 (22%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 91/412 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.