DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina5

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_766541.2 Gene:Serpina5 / 268591 MGIID:107817 Length:405 Species:Mus musculus


Alignment Length:392 Identity:98/392 - (25%)
Similarity:180/392 - (45%) Gaps:50/392 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAY 105
            ::||..:...:...:|.:||||||.|...:|.:...|:...|:.::...|.|.....:|      
Mouse    44 KDFAFRLYRALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQE------ 102

  Fly   106 ILEKMNR-------KERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKS---QTEE 160
              :|:::       :.||....|:.|....:|....:|:.:...:.:........|.:   ..|.
Mouse   103 --DKLHKGFQQLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEI 165

  Fly   161 SRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNY 225
            ::||||:::||||..:|.:.:.  ::.....:::.|..:.|.:|.:.|....|..|.|:.:|...
Mouse   166 AKKQINNYVAKQTKGKIVDFIK--DLDSTHVMIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRT 228

  Fly   226 SLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLED 290
            :.|.||.::..:...:|:.:...|:.:||:                .:...:.|||  :...::.
Mouse   229 TQVPMMNREDGYSYYLDQNISCTVVGIPYQ----------------GNAIALFILP--SEGKMKQ 275

  Fly   291 VLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSET- 354
            |...|:..:|.:.||....|.:::.||||..|...:|..:|.|:|:..:|    .|..||:..| 
Mouse   276 VEDGLDERTLRNWLKMFTKRRLDLYLPKFSIEATYKLENVLPKLGIQDVF----TTHADLSGITD 336

  Fly   355 ---ISIGDSKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILF 415
               |.:.:..|.:.::|:|.|:||||.| .:||:||||| ...|.|...|||..:.:  ...|||
Mouse   337 HTNIKLSEMVHKSMMEVEESGTTAAAITGAIFTFRSARP-SSLKIEFTRPFLLTLME--DSHILF 398

  Fly   416 TG 417
            .|
Mouse   399 VG 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 98/392 (25%)
Serpina5NP_766541.2 serpinA5_PCI 42..405 CDD:381021 98/392 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.