DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINA11

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:392 Identity:95/392 - (24%)
Similarity:171/392 - (43%) Gaps:39/392 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYI 106
            |||:.:...:....|. |:||||.|....|.|...|:..:|...:.:.|..:..::.|    |.|
Human    56 NFALRLYKELAADAPG-NIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPE----ADI 115

  Fly   107 LEKMNRKERQSKMP---LEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEES---RKQI 165
            .:..........:|   ||....:.:|....|...:...:.:.|......|.:...:|   .:||
Human   116 HQGFRSLLHTLALPSPKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANFTDSVTTGRQI 180

  Fly   166 NDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQW---LSQFKTEKTVPMPFYTSPSNYSL 227
            ||::.:||:.|:.:.|  .|.:..|.:||||..:.|.:|   .|:::|:|  ...|:........
Human   181 NDYLRRQTYGQVVDCL--PEFSQDTFMVLANYIFFKAKWKHPFSRYQTQK--QESFFVDERTSLQ 241

  Fly   228 VSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVL 292
            |.||.||.......|:.|...|||:.||                .:...:|:||  :...::.|.
Human   242 VPMMHQKEMHRFLYDQDLACTVLQIEYR----------------GNALALLVLP--DPGKMKQVE 288

  Fly   293 SRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSE-TIS 356
            :.|...:|....:..:|..:::.||:|.......|..||.::|::.:.:.. |.|..:|.: ..:
Human   289 AALQPQTLRKWGQLLLPSLLDLHLPRFSISGTYNLEDILPQIGLTNILNLE-ADFSGVTGQLNKT 352

  Fly   357 IGDSKHVAKIKVDEEGSTAAAATVLFTY-RSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYR 420
            |....|.|.:.:.|:|:.|.||:.|.:. .|...:.......|.|||.::::.|::|:||.|...
Human   353 ISKVSHKAMVDMSEKGTEAGAASGLLSQPPSLNTMSDPHAHFNRPFLLLLWEVTTQSLLFLGKVV 417

  Fly   421 DP 422
            :|
Human   418 NP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 94/387 (24%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 94/387 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.