DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina3c

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:448 Identity:121/448 - (27%)
Similarity:198/448 - (44%) Gaps:67/448 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MAVLPAIAL--AGLCGVEPDAGLL--------DQRLNLYKGQQ-----------NFAVSMLNVIR 52
            ||.:.|:.|  ||:|......|:|        ||.    ||:|           :|.:|:...:.
  Rat     1 MAFIAALGLLMAGICPAVLCDGILGRDTLPHEDQG----KGRQLHSLTLASINTDFTLSLYKKLA 61

  Fly    53 QSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWAD-SKEVVRSAY--ILEKMNRKE 114
            ...|::||.|||.|...||.:...|:...|.:|:.:.|..:..: ::|.:...:  :|:::::.|
  Rat    62 LRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGFGHLLQRLSQPE 126

  Fly   115 RQSKMPLEFSSADRIFFANDLHV----TECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHD 175
            .|:    |.::...:|...:..:    .|..|.....|....||| |..|::|.|||:::.||..
  Rat   127 DQA----EINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFK-QCNEAKKFINDYVSNQTQG 186

  Fly   176 QIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLN 240
            :|..:.|  ::..||.:||.|....||:|...|....|....||........|.||:.|......
  Rat   187 KIAELFS--DLDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVKVPMMKIKDLTTPY 249

  Fly   241 V-DEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSL---D 301
            | ||:|...||:|.|                ..:.|.:.|||  :...::.|.|.|..::|   .
  Rat   250 VRDEELSCSVLELKY----------------TGNASALFILP--DQGKMQQVESSLQPETLKKWK 296

  Fly   302 DSLKQAMPREI-EVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVA 364
            |||:   ||.| |:.:|||.......|..:|.::|:.|:|.:. |....:| ::.:.:....|.|
  Rat   297 DSLR---PRIISELRMPKFSISTDYNLEEVLPELGIRKIFSQQ-ADLSRITGTKNLHVSQVVHKA 357

  Fly   365 KIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            .:.|||.|:..||||.:.....:.|........|.||:.||.|...:|:.|.|...:|
  Rat   358 VLDVDETGTEGAAATAVTAALKSLPQTVPLLNFNRPFMLVITDNNGQSVFFMGKVTNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 108/403 (27%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 105/389 (27%)
RCL 365..392 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.