DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpine1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus


Alignment Length:402 Identity:112/402 - (27%)
Similarity:184/402 - (45%) Gaps:45/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YKGQQ--NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKE 99
            :..||  ||.|.:...:.|::.:.||.||||.....|.:....::|.|.:::...:..:.::.  
  Rat    30 HTAQQATNFGVKVFQHVVQASKDRNVVFSPYGVSSVLAMLQLTTAGKTRQQIQDAMGFNISER-- 92

  Fly   100 VVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDL--------HVTECARNRLAEEVQQIDFKS 156
              .:|..|.|::::...|....|.|:||.||...||        |..:..|.    .|:|:|| |
  Rat    93 --GTAPALRKLSKELMGSWNKNEISTADAIFVQRDLELVQGFMPHFFKLFRT----TVKQVDF-S 150

  Fly   157 QTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTS 221
            :.|.:|..||||:.:.|...|.::|:...:...|||||.||.|..|||.:.|....|....|:.|
  Rat   151 EMERARFIINDWVERHTKGMISDLLAKGAVNELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKS 215

  Fly   222 PSNYSLVSMMQQKGTFLLNVDEQLRAH---VLQLPYRTVFESQEKEDSSPDENSDISMVLILPPF 283
            ..:...|.||.|...|..........|   :|:|||               ....:||.:..|..
  Rat   216 DGSTISVPMMAQNNKFNYTEFTTPDGHEYDILELPY---------------HGETLSMFIAAPFE 265

  Fly   284 NSNSLEDVLSRLNADSLDD--SLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVAT 346
            ....|..:.:.|:|:.:..  |....:||.:  .||||..|..::|...|.|:|::.:|..:.|.
  Rat   266 KDVPLSAITNILDAELIRQWKSNMTRLPRLL--ILPKFSLETEVDLRGPLEKLGMTDIFSSTQAD 328

  Fly   347 FDDLT-SETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTS 410
            |..|: .|.:|:..:....||:|:|.|:.|:::|.:..  ||| :.|.:...:..||||:....:
  Rat   329 FTSLSDQEQLSVAQALQKVKIEVNESGTVASSSTAILV--SAR-MAPTEMVLDRSFLFVVRHNPT 390

  Fly   411 RSILFTGIYRDP 422
            .:|||.|...:|
  Rat   391 ETILFMGQLMEP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 111/395 (28%)
Serpine1NP_036752.2 serpin 29..402 CDD:422956 111/400 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.