DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb13

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:397 Identity:116/397 - (29%)
Similarity:186/397 - (46%) Gaps:58/397 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD-WADSKEVVRSAYILEKMNRKERQSK 118
            |.:.||||||.....|:.:...|:.|.|..||.|||:.: ..:|..:......:||......|.:
Mouse    22 TNDGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIKSEEEEIEKREEIHHQLQ 86

  Fly   119 MPL-EFSSADRIFFANDLHVTECARNRLAEE--------------------VQQIDFKSQTEESR 162
            |.| |.|.     |:||..:  ...|||..|                    ::.:||.:..:|||
Mouse    87 MLLTEISK-----FSNDYDL--IISNRLFGEKTYLFLQKYIDYVEKYYHASLEPVDFVNAADESR 144

  Fly   163 KQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSL 227
            |:||.|:..||:.:::::.....:...|:|||.|..|.||.|..:||.|.|....|:.:.:....
Mouse   145 KKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDFWLNKNLSKP 209

  Fly   228 VSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVL 292
            |.||....:|.....|.|:|.::.:||:               |:||||.::||. :.:.||.::
Mouse   210 VQMMALCSSFNFTFLEDLQAKIVGIPYK---------------NNDISMFVLLPN-DIDGLEKIM 258

  Fly   293 SRLNADSLDD-----SLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTS 352
            .:::.:.|.:     .|:|   |.:::.||:.:.|:..:|.|:|..:|:...|.|. |.:..:::
Mouse   259 DKMSPEKLVEWTSPGHLEQ---RRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEH-ADYSGMSA 319

  Fly   353 ET-ISIGDSKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILF 415
            .: :...:..|.:.:.|.|||..|.|.| |.....||...|  ...|||||||.|..|.|.||||
Mouse   320 RSGLHAQNFLHRSFLVVTEEGVEATAGTGVGLKVSSAASCE--LVHCNHPFLFFIRHRESDSILF 382

  Fly   416 TGIYRDP 422
            .|.:..|
Mouse   383 FGKFSSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 115/392 (29%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 115/395 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.