DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb6d

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001070258.1 Gene:Serpinb6d / 238568 MGIID:2667783 Length:375 Species:Mus musculus


Alignment Length:403 Identity:113/403 - (28%)
Similarity:193/403 - (47%) Gaps:47/403 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD--WADSK 98
            |.|....||..:|..:...| ::|:|.||.|...:|.:...|:..:|.:::.:.|.||  .:|..
Mouse     4 LPKLNTKFAFKLLKALDDDT-SKNIFLSPPSIASSLAMTLLGAKENTARQIRQTLSLDKCSSDPC 67

  Fly    99 EVVRSAY--ILEKMNRKERQSKMPLEFSSADRIFFANDLHV----TECARNRLAEEVQQIDFKSQ 157
            |.:...:  :|.::|:.:....:..|    :|:|.....|:    .:.::.....|::::|||..
Mouse    68 EDIHQDFHLLLNEVNKTDPGIILKTE----NRLFVEKTFHIKKSFKDASQKFYKAEIEELDFKGD 128

  Fly   158 TEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSP 222
            ||:||:.||.|:.|.|.::|:::||...:...|||||.|..|.||.|...|..|.|..|||..|.
Mouse   129 TEQSRQHINTWVTKNTDEKIKDLLSPGSVNSNTRLVLVNDFYFKGYWEKPFNKEDTREMPFRVSK 193

  Fly   223 SNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNS 287
            :....|.||.||.||.:...|::...:|.|||               ..:.::|:::||.     
Mouse   194 NVVKPVQMMFQKSTFKITYIEEISTKILLLPY---------------AGNKLNMIIMLPD----- 238

  Fly   288 LEDVLSRLNADSLD-------DSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVA 345
             |.|..|:....:.       .||.:....|:||.||:|:.|:..::|.:|.|||::..|:|..|
Mouse   239 -EHVELRMLEKKMTYEKFVEWTSLDKMNEEEVEVFLPRFKLEEIYDMNNVLYKMGMTDAFEEGRA 302

  Fly   346 TFDDLTS-ETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRT 409
            .|..::| :.:.:....:.|.|:|.|:|:..||||.: ....|.|.... |..:|||:|.   ..
Mouse   303 DFSGISSKQGLFLSKVIYKAFIEVIEKGTKVAAATDI-VMMGASPTTHT-FCADHPFIFT---HM 362

  Fly   410 SRSILFTGIYRDP 422
            :...:..|.:..|
Mouse   363 TEDFMIIGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 110/395 (28%)
Serpinb6dNP_001070258.1 SERPIN 4..375 CDD:294093 112/401 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.