DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina3f

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:418 Identity:113/418 - (27%)
Similarity:185/418 - (44%) Gaps:69/418 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LNLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSK 98
            |.|.....:||.|:...:....|:|||.|||:|...||.|...|:..:|.||:.:.|..:..::.
Mouse    35 LTLASSNTDFAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETP 99

  Fly    99 EV-VRSA--YILEKMNRKERQSKMPLEFSSADRIFFANDLHV----TECARNRLAEEVQQIDFKS 156
            |. :...  |:|:.:::...|    ::.|:...:|....|.:    .|.||.....|....||: 
Mouse   100 EPDIHQGFRYLLDLLSQPGNQ----VQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQ- 159

  Fly   157 QTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTS 221
            |..|:.|.|||:::..|..:|:.::|  ::..||.:||.|..|.||:|...|..:.|....||..
Mouse   160 QPLEATKLINDYVSNHTQGKIKELIS--DLDKRTLMVLVNYIYFKGKWEMPFDPDDTCKSEFYLD 222

  Fly   222 PSNYSLVSMMQQKGTFLLNV------DEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLIL 280
            .:....|.||:     :.|:      ||:|...|::|.|                ..:.|.:.||
Mouse   223 ENRSVKVPMMK-----INNLTTPYFRDEELSCTVVELKY----------------TGNASAMFIL 266

  Fly   281 PPFNSNSLEDVLSRLNADSL---DDSLKQAMPREI-EVSLPKFEFEQRLELNPILAKMGVSKMFD 341
            |  :...::.|.:.|..::|   .||||   ||.| |:.||||.......|..||.::|:.::|.
Mouse   267 P--DQGKMQQVEASLQPETLRNWKDSLK---PRLINELCLPKFSISTDYSLEHILPELGIRELFS 326

  Fly   342 ES------VATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSAR----PVEPAKFE 396
            ..      ..|.|..||:.:      |.|.:.|.|.|:.|||.|   .|::.:    .:...|..
Mouse   327 TQADLSAITGTKDLRTSQVV------HKAVLDVAETGTEAAAGT---GYQNLQCCQGVIYSMKIY 382

  Fly   397 CNHPFLFVIYDRTSRSILFTGIYRDPKT 424
            .:.|||.:|.|..:...||.....:|::
Mouse   383 FDRPFLMIISDTNTHIALFMAKVSNPES 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 110/406 (27%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 110/406 (27%)
RCL 357..382 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.