DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb9d

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_035590.1 Gene:Serpinb9d / 20726 MGIID:894667 Length:377 Species:Mus musculus


Alignment Length:398 Identity:126/398 - (31%)
Similarity:201/398 - (50%) Gaps:35/398 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV 100
            |.:....||:.:|.|:.|..|:|||.|||.|...||.:...|:.|:|..::.:.|||   :..|.
Mouse     4 LSQANGTFAIHLLKVLCQDNPSENVCFSPMSISSALAMVLLGAKGNTVTQICQALHL---NPDED 65

  Fly   101 VRSAY--ILEKMNRKERQSKMPLEFSSADRIFFANDLHV----TECARNRLAEEVQQIDFKSQTE 159
            |...:  :|..:|:...|...   .:.|:|:|..|...:    .|........|::|:.|....|
Mouse    66 VHQGFQLLLHNLNKPNNQKYC---LTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAE 127

  Fly   160 ESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224
            |||:.||.|::|||:.:|.::|..|.|..:|||:||||.|.:|.|...|:.:.|..|||..:...
Mouse   128 ESRQHINMWVSKQTNGKIPDLLPKDSIDSQTRLILANALYFQGTWYKLFEKDSTKEMPFKINKKE 192

  Fly   225 YSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPP--FNSNS 287
            ...|.||.|:..|.....::::|.||.:||               |..|:|.|::||.  .:.:.
Mouse   193 TRPVQMMWQEDRFYHAYVKEIQAQVLVMPY---------------EGIDLSFVVLLPDKGVDISK 242

  Fly   288 LEDVLS--RLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDL 350
            :|:.|:  :|.|.:..|.:...   |:.|.||||:.::..::|.:|..:|:..:||.|.|....:
Mouse   243 VENNLTFEKLTAWTKPDFMNGI---ELHVYLPKFQLQEDYDMNSLLQHLGILDVFDGSKADLSGM 304

  Fly   351 -TSETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSIL 414
             |.|.:.:.:..|...::|:|||:.|||||...|.:......|..|..:|||||.|...|:.|||
Mouse   305 STKENLCLSNFVHKCVVEVNEEGTEAAAATAGKTIQCCLGSYPQTFCADHPFLFFIMHSTTNSIL 369

  Fly   415 FTGIYRDP 422
            |.|.:..|
Mouse   370 FCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 124/390 (32%)
Serpinb9dNP_035590.1 serpin 1..377 CDD:393296 125/396 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.