DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb8

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus


Alignment Length:406 Identity:123/406 - (30%)
Similarity:214/406 - (52%) Gaps:52/406 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKE 99
            :|.:...:||:|:|.::.:...:.|:||.|.|...||.:.|.|:.|:|..::::||.|  :.:.:
Mouse     3 DLSEANGSFAISLLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLGL--SGNGD 65

  Fly   100 VVRS-AYILEKMNRKERQSKMPLEFSSADRIF----------FANDLHVTECARNRLAEEVQQID 153
            |.:| ..:|.::|:.:.|..:    .||.|:|          |....|....|      .::::.
Mouse    66 VHQSFQTLLAEINKTDTQYLL----KSACRLFGEESCDFLSTFKESCHKFYQA------GLEELS 120

  Fly   154 FKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPF 218
            |...||..||.||||::::|..:|..:||...:.|.|:|||.||.|.||:|.:||..:.|..|||
Mouse   121 FAKDTEGCRKHINDWVSEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPF 185

  Fly   219 YTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSS----PDENSDISMVLI 279
            .|:... ..|.||.:...|.:...:::...||.|||      .|:|.|.    |||::|:::|  
Mouse   186 KTNQEK-KTVQMMFKHAKFKMGHVDEVNMQVLALPY------AEEELSMVILLPDESTDLAVV-- 241

  Fly   280 LPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESV 344
               ..:.:.|.:.:..|.::|.:|       :::|.||:.:.|:..:|..:|..:|::..|:|:.
Mouse   242 ---EKALTYEKLRAWTNPETLTES-------QVQVFLPRLKLEESYDLETVLQNLGMTDAFEETR 296

  Fly   345 ATFDDLTS-ETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSAR--PVEPAKFECNHPFLFVIY 406
            |.|..:|: :.:.:....|...::|:|||:.|||||.:.  |:||  ..|| :|..:|||||.|:
Mouse   297 ADFSGMTTKKNVPVSKVAHKCFVEVNEEGTEAAAATAVI--RNARCCRTEP-RFCADHPFLFFIW 358

  Fly   407 DRTSRSILFTGIYRDP 422
            ...:.||||.|.:..|
Mouse   359 HHKTSSILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 121/397 (30%)
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 122/403 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.