DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina3m

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_033279.2 Gene:Serpina3m / 20717 MGIID:98378 Length:418 Species:Mus musculus


Alignment Length:447 Identity:125/447 - (27%)
Similarity:206/447 - (46%) Gaps:61/447 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MAVLPA--IALAGLC-----------GVE------PDAGLLDQRLNLYKGQQNFAVSMLNVIRQS 54
            ||.:.|  |.:||:|           |::      .::|..|..|.|.....:||.|:...:...
Mouse     1 MAFIAALGILMAGICPTVLCFSDDTWGIDILLHKNQESGTPDDSLTLASINTDFAFSLYKKMALK 65

  Fly    55 TPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-VRSAY--ILEKMNRKERQ 116
            .|::|:.|||.|...||.|...|:.|:|.:|:.:.|..:..::.|. :...:  :|:::::.|.|
Mouse    66 NPDKNIVFSPLSISAALALVSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLSQPEDQ 130

  Fly   117 SKMPLEFSSADRIFFANDLHVT----ECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQI 177
            .::.:    .:.:|...||.:.    |..|.....|....||:..| |:.|.|||:::.||...|
Mouse   131 DQINI----GNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPT-EATKLINDYVSNQTQGMI 190

  Fly   178 RNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLN-- 240
            :.::|  |:..||.:||.|..|.||:|...|..:.|....||........|.||:.|  ||..  
Mouse   191 KKLIS--ELDDRTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVKVPMMKMK--FLTTRH 251

  Fly   241 -VDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSL 304
             .||:|...||:|.|                ..:.|.:.|||  :...::.|.:.|..::|....
Mouse   252 FRDEELSCSVLELKY----------------TGNASALFILP--DQGRMQQVEASLQPETLRKWW 298

  Fly   305 KQAMPREI-EVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVAKIK 367
            |....|:| |:.||||.......|..||.::|:.::|.:. |....:| ::.:|:....|.|.:.
Mouse   299 KSLKTRKIGELYLPKFSISTDYNLKDILPELGIKEIFSKQ-ADLSGITGTKDLSVSQVVHKAVLD 362

  Fly   368 VDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
            |.|.|:.||||| .:|.:||.| ::....:.|.|||.||.....::.||.....:||
Mouse   363 VAETGTEAAAATGFIFGFRSRR-LQTMTVQFNRPFLMVISHTGVQTTLFMAKVTNPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 111/392 (28%)
Serpina3mNP_033279.2 SERPIN 56..417 CDD:214513 109/389 (28%)
RCL 367..392 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.