DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina3n

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:452 Identity:126/452 - (27%)
Similarity:202/452 - (44%) Gaps:71/452 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MAVLPAIAL--AGLCGVE---PDAGL---------------LDQRLNLYKGQQNFAVSMLNVIRQ 53
            ||.:.|:.|  ||:|...   ||..|               ||. |.|.....:||.|:...:..
Mouse     1 MAFIAALGLLMAGICPAVLCFPDGTLGMDAAVQEDHDNGTQLDS-LTLASINTDFAFSLYKELVL 64

  Fly    54 STPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-VRSAY--ILEKMNRKER 115
            ..|::|:.|||.|...||.:...|:.|:|.:|:.:.|..:..::.|. :...:  :|:::|    
Mouse    65 KNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLN---- 125

  Fly   116 QSKMPLEFSSADRIFFANDLHV----TECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQ 176
            |.|..::.|:...:|......:    .|.||.....|....||: |..:::|.|||::.|||...
Mouse   126 QPKDQVQISTGSALFIEKRQQILTEFQEKARALYQAEAFTADFQ-QPRQAKKLINDYVRKQTQGM 189

  Fly   177 IRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKG-TFLLN 240
            |:.::|  ::..||.:||.|..|.|.:|...|....|....||.......:|.||..:. |....
Mouse   190 IKELVS--DLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYF 252

  Fly   241 VDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSL---DD 302
            .||:|...|::|.|                ..:.|.:.|||  :...::.|.:.|..::|   .:
Mouse   253 RDEELFCTVVELKY----------------TGNASAMFILP--DQGKMQQVEASLQPETLRKWKN 299

  Fly   303 SLKQAMPREI-EVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSET----ISIGDSKH 362
            |||   ||.| |:.||||.......|..:|:|:|:.::|    :|..||::.|    :.:....|
Mouse   300 SLK---PRMIDELHLPKFSISTDYSLEDVLSKLGIREVF----STQADLSAITGTKDLRVSQVVH 357

  Fly   363 VAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
            .|.:.|.|.|:.||||| |.|...||: :.|.....|.|||.:|:|..:....|.....:||
Mouse   358 KAVLDVAETGTEAAAATGVKFVPMSAK-LYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 110/396 (28%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 114/414 (28%)
RCL 367..392 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.