DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb9e

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_035586.1 Gene:Serpinb9e / 20710 MGIID:894672 Length:377 Species:Mus musculus


Alignment Length:400 Identity:124/400 - (31%)
Similarity:201/400 - (50%) Gaps:39/400 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV 100
            |.:....||:.:|.|:.|..|:|||.:||.|...||.:...|:.|||..::.:.|||   :..|.
Mouse     4 LSQANGTFAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLGAKGDTAVQICQALHL---NPDED 65

  Fly   101 VRSAY--ILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAE----EVQQIDFKSQTE 159
            |...:  :|..:|:...|...   .:.|:|:|..|...:....:....:    |::|:.|....|
Mouse    66 VHQGFQLLLHNLNKPNNQKYC---LTMANRLFVENTCELLPTFKKSCLKFYHSEIEQLSFAEAAE 127

  Fly   160 ESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224
            |||:.||.|::|||..:|.::||.|.:..:|||:||||.|.:|.|...|:.:.|..:||..:...
Mouse   128 ESRQHINMWVSKQTKGKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDSTKEVPFKINKKE 192

  Fly   225 YSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLE 289
            ...|.||.|:.||.....::::|.||.:||               |..|::.|::||. ....:.
Mouse   193 TRPVQMMWQEDTFFHAYVKEIQAQVLVMPY---------------EGIDLNFVVLLPD-QGVDIS 241

  Fly   290 DVLSRLNADSLDDSLK-QAMPR-EIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDL-T 351
            .|.:.|..:.|....| :.|.| |:.|.||||:.::..::|.:|..:|:..:|:.|.|.|..: |
Mouse   242 KVENNLTFEKLTAWTKPEFMNRTELHVYLPKFKLQEDYDMNSLLQHLGILDVFNGSKADFSGMST 306

  Fly   352 SETISIGDSKHVAKIKVDEEGSTAAAAT----VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRS 412
            .|.:.:....|...::|:|||:.|.||:    :||    ....:|..|..:|||||.|...|:.|
Mouse   307 KENLCLSKFVHKCVVEVNEEGTEAVAASAGKIILF----CDGPDPEVFCADHPFLFFIMHSTTNS 367

  Fly   413 ILFTGIYRDP 422
            |||.|.:..|
Mouse   368 ILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 122/392 (31%)
Serpinb9eNP_035586.1 SERPIN 4..377 CDD:294093 123/398 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.