DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb6b

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_035584.1 Gene:Serpinb6b / 20708 MGIID:894688 Length:377 Species:Mus musculus


Alignment Length:397 Identity:123/397 - (30%)
Similarity:198/397 - (49%) Gaps:33/397 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSK-- 98
            |.:....||:::|..:.:.: :.||.|||.|...||.:.:.|:.|.|..::|:.|.||....|  
Mouse     4 LLEANATFALNLLKTLGEDS-SRNVLFSPISVSSALAMVFMGAKGTTASQMAQALSLDKCSGKGG 67

  Fly    99 EVVRSAY--ILEKMNRKERQSKMPLEFSSADRIFFANDLHV----TECARNRLAEEVQQIDFKSQ 157
            ..|...:  :|.:.|:...|..:    .:|:|:|......:    .:..|.....|::::|||..
Mouse    68 RDVHQGFQSLLTETNKTGTQYVL----RTANRLFGEKTFDILASFKDSCRKFYEAEMEELDFKGA 128

  Fly   158 TEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSP 222
            ||:||:.||.|:||:|.|:|..:||:..:...|.|||.||.|.||.|..||..|.|..|||..:.
Mouse   129 TEQSRQHINAWVAKKTEDKITELLSSGSVNSNTPLVLVNAIYFKGNWEKQFNKEDTQEMPFNVTK 193

  Fly   223 SNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNS 287
            .....|.||.||.||.:...|::..::|.|||  |..........|||:.::|||     ....:
Mouse   194 DVVKPVQMMFQKSTFKMTYVEEISTNILLLPY--VGNELNMIIMLPDEHIELSMV-----EKEIT 251

  Fly   288 LEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTS 352
            .:..:.....|.:::       .|:||.||||:.|:..::..:|.::|::..|:|.:|.|..:.|
Mouse   252 YKKFIEWTRLDKMEE-------EEVEVFLPKFKLEENYDMKDVLCRLGMTDAFEEGMADFSGIAS 309

  Fly   353 -ETISIGDSKHVAKIKVDEEGSTAAAATVL-FTYRSARPVEPAKFECNHPFLFVIYDRTSRSILF 415
             |.:.:....|.:.::|:|||:.|||||.. ..:|...|.    |..||||||.|....:..|:|
Mouse   310 KEGLFLSKVIHKSFVEVNEEGTEAAAATAANIGFRCMVPY----FCANHPFLFFIQHSRTSGIVF 370

  Fly   416 TGIYRDP 422
            .|.:..|
Mouse   371 CGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 121/389 (31%)
Serpinb6bNP_035584.1 serpin 1..377 CDD:393296 122/395 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.