DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb9b

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:408 Identity:119/408 - (29%)
Similarity:203/408 - (49%) Gaps:55/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV 100
            |.:....||:.:|.::.||.|::||.|||.|...||.:...|:...|..::::.|.|   ..::.
Mouse     4 LSEANGTFAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALGL---KKEKG 65

  Fly   101 VRSAY--ILEKMNRKERQSKMPLEFSSADRIFFANDLHVTE-----CARNRLAEEVQQIDFKSQT 158
            :...:  :|.|:|:.:|:..:.:    |:|:|......|.:     |.| ....|::|::|....
Mouse    66 IHQGFLKLLRKLNKPDRKYSLIV----ANRLFADKTCEVLQTFKESCFR-FYDSEMEQVNFFKAA 125

  Fly   159 EESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPS 223
            .|||:.||.|::|||..:|..:|:.|.:..:|||||.||.|.||.|..||..|.|..||||.:..
Mouse   126 VESRQCINTWVSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKD 190

  Fly   224 NYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSL 288
            ....|.||.|..||:....::|.|.:|.:||               |..::|::::||....:  
Mouse   191 EKRPVQMMCQTDTFMFAFVDELPARLLIMPY---------------EGMELSLMVLLPEKGVD-- 238

  Fly   289 EDVLSRLNAD-SLDDSLKQAMP-----REIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATF 347
               ||::..| :.:..:....|     .|::|.||||:.::..|:..:|..:|:..:|::..|..
Mouse   239 ---LSKVENDLTFEKLIAWTKPDIMWSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADL 300

  Fly   348 DDLTSE-TISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPV-------EPAKFECNHPFLFV 404
            ..::.| .:.:....|.:.::|:|||:.||||:      ||..:       .|:.|..:|||||.
Mouse   301 SAMSPERNLCLSKFIHKSVVEVNEEGTEAAAAS------SAEGIIPLCLGGGPSWFCADHPFLFF 359

  Fly   405 IYDRTSRSILFTGIYRDP 422
            |....:.||||.|.:..|
Mouse   360 IRHNQTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 117/400 (29%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 118/406 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.