DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina1e

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:441 Identity:118/441 - (26%)
Similarity:203/441 - (46%) Gaps:57/441 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SISLMAVLPAIALAGLCGVEP----------DAGLLDQRLNLYKGQQN---FAVSMLNVIRQSTP 56
            |||...:|    |||||.:.|          |....||....::...|   ||:|:...:...:.
Mouse     4 SISWCLLL----LAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSN 64

  Fly    57 NENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-VRSAY--ILEKMNRKERQSK 118
            ..|:||||.|...|..:...||.|||..::.:.|..:...:.|. :.:::  :|:.:||.:.:  
Mouse    65 TSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHNSFQHLLQTLNRPDSE-- 127

  Fly   119 MPLEFSSADRIFFANDLHVTEC----ARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRN 179
              |:.|:.:.:|..|||.:.|.    |:|....||..::| :::||::|.|||::.|.|..:|  
Mouse   128 --LQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNF-AESEEAKKVINDFVEKGTQGKI-- 187

  Fly   180 MLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQ 244
            :.:..::...|..||||....||:|...|..|.|....|:...|....|.||...|...::....
Mouse   188 VEAVKKLEQDTVFVLANYILFKGKWKKPFDPENTKQAEFHVDESTTVKVPMMTLSGMLDVHHCST 252

  Fly   245 LRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMP 309
            |.:.||.:.|.                .:.:.|.:||  :...::.:...||.:.:...|.....
Mouse   253 LSSWVLLMDYA----------------GNATAVFLLP--DDGKMQHLEQTLNKELISKFLLNRRR 299

  Fly   310 REIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSET--ISIGDSKHVAKIKVDEEG 372
            |..::.:|:........|..:::.:|::::|: |.|....:|.|.  :.:..:.|.|.:.:||.|
Mouse   300 RLAQIHIPRLSISGNYNLETLMSPLGITRIFN-SGADLSGITEENAPLKLSQAVHKAVLTIDETG 363

  Fly   373 STAAAATVL-FTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            :.||||||| ..:.|..|:    ...|.||||:|::..|:|.||.|...||
Mouse   364 TEAAAATVLQGGFLSMPPI----LHFNRPFLFIIFEEHSQSPLFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 103/392 (26%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 100/386 (26%)
RCL 368..387 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.