DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina1b

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_033270.3 Gene:Serpina1b / 20701 MGIID:891970 Length:413 Species:Mus musculus


Alignment Length:431 Identity:115/431 - (26%)
Similarity:197/431 - (45%) Gaps:53/431 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IALAGLCGVEP----------DAGLLDQRLNLYKGQQN---FAVSMLNVIRQSTPNENVFFSPYS 66
            :.|||||.:.|          |....||....::...|   ||:|:...:...:...|:||||.|
Mouse    10 LLLAGLCCMVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVS 74

  Fly    67 TYHALLLAYFGSSGDTEKELAKVLHLDWADSKE--VVRS-AYILEKMNRKERQSKMPLEFSSADR 128
            ...|..:...||.|||..::.:.|..:...:.|  :.:| .::|:.:||.:.:    |:.|:.:.
Mouse    75 IATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSE----LQLSTGNG 135

  Fly   129 IFFANDLHVTEC----ARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPR 189
            :|..|||.:.|.    |:|....||..::| :::||::|.|||::.|.|..:|  :.:..|:...
Mouse   136 LFVNNDLKLVEKFLEEAKNHYQAEVFSVNF-AESEEAKKVINDFVEKGTQGKI--VEAVKELDQD 197

  Fly   190 TRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPY 254
            |...|||....||:|...|..|.|....|:...|....|.||...|...::....|.:.||.:.|
Mouse   198 TVFALANYILFKGKWKKPFDPENTEEAEFHVDKSTTVKVPMMMLSGMLDVHHCSILSSWVLLMDY 262

  Fly   255 RTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKF 319
            .                .:.|.|.:||  ....::.:...||.:.:...|.....|.:::.:|:.
Mouse   263 A----------------GNASAVFLLP--EDGKMQHLEQTLNKELISKILLNRRRRLVQIHIPRL 309

  Fly   320 EFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSK--HVAKIKVDEEGSTAAAATVLF 382
            .......|..:::.:|::::|:.. |....:|.|...:..||  |.|.:.:||.|:.||||||. 
Mouse   310 SISGDYNLKTLMSPLGITRIFNNG-ADLSGITEENAPLKLSKAVHKAVLTIDETGTEAAAATVF- 372

  Fly   383 TYRSARPVE-PAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
               .|.|:. |.....:|||||:|::..::|.:|.|...||
Mouse   373 ---EAVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 104/392 (27%)
Serpina1bNP_033270.3 SERPIN 53..410 CDD:214513 101/386 (26%)
RCL 368..387 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.