DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina1a

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001239498.1 Gene:Serpina1a / 20700 MGIID:891971 Length:436 Species:Mus musculus


Alignment Length:431 Identity:110/431 - (25%)
Similarity:196/431 - (45%) Gaps:53/431 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IALAGLCGVEP----------DAGLLDQRLNLYKGQQN---FAVSMLNVIRQSTPNENVFFSPYS 66
            :.|||||.:.|          |....||....::...|   ||:|:...:...:...|:||||.|
Mouse    33 LLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVS 97

  Fly    67 TYHALLLAYFGSSGDTEKELAKVLHLDWADSKE--VVRS-AYILEKMNRKERQSKMPLEFSSADR 128
            ...|..:...||.|||..::.:.|..:...:.|  :.:| .::|:.:||.:.:    |:.|:.:.
Mouse    98 IATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSE----LQLSTGNG 158

  Fly   129 IFFANDLHVTEC----ARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPR 189
            :|..|||.:.|.    |:|....||..::| :::||::|.|||::.|.|..:|..  :..::...
Mouse   159 LFVNNDLKLVEKFLEEAKNHYQAEVFSVNF-AESEEAKKVINDFVEKGTQGKIAE--AVKKLDQD 220

  Fly   190 TRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPY 254
            |...|||....||:|...|..|.|....|:...|....|.||...|...::....|.:.||.:.|
Mouse   221 TVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDY 285

  Fly   255 RTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKF 319
            .                .:.:.|.:||  :...::.:...|:.:.:...|.....|..::..|:.
Mouse   286 A----------------GNATAVFLLP--DDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRL 332

  Fly   320 EFEQRLELNPILAKMGVSKMFDESVATFDDLTSET--ISIGDSKHVAKIKVDEEGSTAAAATVL- 381
            .......|..:::.:|::::|:.. |....:|.|.  :.:..:.|.|.:.:||.|:.|||.||| 
Mouse   333 SISGEYNLKTLMSPLGITRIFNNG-ADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQ 396

  Fly   382 FTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            ....|..|:  .:|:  |||||:|::..::|.:|.|...||
Mouse   397 MVPMSMPPI--LRFD--HPFLFIIFEEHTQSPIFLGKVVDP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 99/392 (25%)
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 96/386 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.