DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinf1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_035470.3 Gene:Serpinf1 / 20317 MGIID:108080 Length:417 Species:Mus musculus


Alignment Length:396 Identity:92/396 - (23%)
Similarity:162/396 - (40%) Gaps:51/396 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAY- 105
            ||...:..:...::|..||..||.|...||.....|:...||..:.:.|:.|...:.: :.|.| 
Mouse    59 NFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPD-IHSTYK 122

  Fly   106 -ILEKMNRKERQSKMPLEFSSADRIFFANDLHVTEC----------ARNRLAEEVQQIDFKSQTE 159
             :|..:...|:..|      ||.||.|...|.|...          .|.|:.....::|.     
Mouse   123 ELLASVTAPEKNLK------SASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDL----- 176

  Fly   160 ESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224
               ::||:|:..|...:|..  |..|:.....::|...||.||||:::|.:.||....|:.....
Mouse   177 ---QEINNWVQAQMKGKIAR--STREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDR 236

  Fly   225 YSLVSMMQQ-KGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSL 288
            ...|.||.. |......:|..|...:.|||.                ...:|::..||...:.:|
Mouse   237 TVRVPMMSDPKAILRYGLDSDLNCKIAQLPL----------------TGSMSIIFFLPLTVTQNL 285

  Fly   289 EDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSE 353
            ..:...|.::.:.|..::....:..:::||.:.....||...|..|.:..:|:.  ..|..:|.:
Mouse   286 TMIEESLTSEFIHDIDRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFES--PDFSKITGK 348

  Fly   354 TISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGI 418
            .:.:...:|.|..:.:|||:.::.:..|...|...|::   :..|.|||||:.|..:.::||.|.
Mouse   349 PVKLTQVEHRAAFEWNEEGAGSSPSPGLQPVRLTFPLD---YHLNQPFLFVLRDTDTGALLFIGR 410

  Fly   419 YRDPKT 424
            ..||.:
Mouse   411 ILDPSS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 90/389 (23%)
Serpinf1NP_035470.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..41
PEDF 39..414 CDD:239007 90/392 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.