DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINB1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:414 Identity:125/414 - (30%)
Similarity:198/414 - (47%) Gaps:65/414 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV 100
            |......||:.:...:.::.|..|:|.||:|...|:.:.:.|:.|:|..:|:|..|.   ::.|.
Human     4 LSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF---NTVEE 65

  Fly   101 VRS--------------AYILEKMNR---KERQSKMPLEFSSADRIFFANDLHVTECARNRLAEE 148
            |.|              :|||:..||   ::..:.:| ||..:.:..:..||             
Human    66 VHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLP-EFLVSTQKTYGADL------------- 116

  Fly   149 VQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKT 213
             ..:||:..:|::||.||.|:..||..:|..:|::..:...|:|||.||.|.||.|..:|..|.|
Human   117 -ASVDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEAT 180

  Fly   214 VPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVL 278
            ...||..:..:...|.||.||..|.....|.|:..||:|||               :..::|||:
Human   181 TNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPY---------------QGEELSMVI 230

  Fly   279 ILP---PFNSNSLEDVLSRLNADSLDDSLKQAMPR-----EIEVSLPKFEFEQRLELNPILAKMG 335
            :||   ...|..|:.:..:|..:.|.:..|   |.     |:.||||:|:.|:...||..||::|
Human   231 LLPDDIEDESTGLKKIEEQLTLEKLHEWTK---PENLDFIEVNVSLPRFKLEESYTLNSDLARLG 292

  Fly   336 VSKMFDESVATFDDLT-SETISIGDSKHVAKIKVDEEGSTAAAATV-LFTYRSARPVEPAKFECN 398
            |..:|:.|.|....:: :..|.|....|.:.::|:|||:.|||||. :.|:....|.|  .|..:
Human   293 VQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE--NFTAD 355

  Fly   399 HPFLFVIYDRTSRSILFTGIYRDP 422
            |||||.|...:|.||||.|.:..|
Human   356 HPFLFFIRHNSSGSILFLGRFSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 123/406 (30%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 124/412 (30%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 13/27 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.