DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina16

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_112098.3 Gene:Serpina16 / 194604 MGIID:2684892 Length:440 Species:Mus musculus


Alignment Length:409 Identity:100/409 - (24%)
Similarity:165/409 - (40%) Gaps:70/409 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWA---DSKEVVR 102
            |.||:|:...:.:|...:||.|||.|....|:|..|....:..:::.:.|.....   |:|..|:
Mouse    70 QKFALSLYTQLPKSKLGKNVIFSPLSITMPLVLLAFQDKPEARRQVLQGLGFGVTGALDAKAAVQ 134

  Fly   103 SAYILEKMNRKERQSKMPLEFSS--ADRIFFAN-----DLHVTECARNRLAEEVQQIDFKSQTEE 160
            ...:|..:        :|.|...  ...:||.:     .......|.:..:.:|..|.|.:. :.
Mouse   135 YGKLLSAL--------LPAEHCGIHTGSLFFIDKTLKPQTTFLTLANSSYSSDVILISFGNH-KL 190

  Fly   161 SRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNY 225
            ::|||:..|..:|..::..:|.  .:.|.|.|.|.|....||:|..:|.       |.||...|:
Mouse   191 AKKQIDLAIKVKTQGKVTRLLR--NLKPPTHLFLTNYNLFKGKWKYRFN-------PKYTGMRNF 246

  Fly   226 S-------LVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPF 283
            |       ||.|||:.|.|.|.....:.::|||||:                ..:||.|..||  
Mouse   247 SLSNGTNILVPMMQKIGWFQLKYFSHIHSYVLQLPF----------------TCNISGVFFLP-- 293

  Fly   284 NSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFD 348
            |...|::....|...|.:..::....|:..:..|||.....|:|..........|:|::.:    
Mouse   294 NDGDLKECEKALLEQSFNTWIQPFPLRKRWLFFPKFSIPVALQLESFKHVNSSLKLFNKRM---- 354

  Fly   349 DLTSETIS-----IGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEP--AKFECNHPFLFVIY 406
            ||:..|:.     :..:.|.|::.|.|:|.....:      .|....||  |....|..||.:|.
Mouse   355 DLSGITLQKAPLRVTMAVHRAELAVSEDGEGEDVS------NSRVNPEPGLAALHFNRSFLLLIL 413

  Fly   407 DRTSRSILFTGIYRDPKTI 425
            |..|:|:||.|...:|..:
Mouse   414 DEASKSLLFMGRVLNPTRV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 99/401 (25%)
Serpina16XP_112098.3 serpin 61..431 CDD:393296 100/406 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.