DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina3c

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_011242304.1 Gene:Serpina3c / 16625 MGIID:102848 Length:436 Species:Mus musculus


Alignment Length:446 Identity:117/446 - (26%)
Similarity:195/446 - (43%) Gaps:62/446 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MAVLPAIAL--AGLC-GV--EPDAGLLDQRLNLYKGQQN---------------FAVSMLNVIRQ 53
            ||.:.|:.|  .|:| ||  .|| |.|::....:|.::|               ||.|:...:..
Mouse    20 MAFIVALGLVITGICPGVLCFPD-GTLERDTLFHKDKENGTQLDSLTLASINTDFAFSLYKKLAL 83

  Fly    54 STPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-VRSAY--ILEKMNRKER 115
            ..|:.|:.|||.|...||.:...|:.|:|.:|:.:.|:.:..::.|. :...:  :|::::....
Mouse    84 KNPDTNIVFSPLSISAALAIVSLGAKGNTLEEILEGLNFNLTETPEADIHQGFGHLLQRLSHPGE 148

  Fly   116 QSKMPLEFSSADRIFFANDLHV----TECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQ 176
            |    ::.|:...:|....|.:    .|.||.....|....||: |..|:.|.|||:::.||..:
Mouse   149 Q----VQISTGSALFVEKHLQILAEFQEKARALYQAEAFTADFQ-QPLEATKLINDYVSNQTQRK 208

  Fly   177 IRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKG-TFLLN 240
            |:.::|  ::...|.:||.|..|.||:|...|....|....||........|.||:.|. |....
Mouse   209 IKGLIS--DLDTDTLMVLVNYIYFKGKWKMPFNPRDTFESEFYLDVKRSVKVPMMKIKTLTTPYF 271

  Fly   241 VDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLK 305
            .||:|...|::|.|:                .:.|.:.|||  :...::.|.:.|..::|.....
Mouse   272 RDEELSCTVVELKYK----------------GNASALFILP--DQGRMQQVEASLQPETLRKWKN 318

  Fly   306 QAMPREI-EVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVAKIKV 368
            ...||:: |:.||||.......|..||.::|:.::|.:. |....:| ::.:.:....|.|.:.|
Mouse   319 SLRPRKMGELYLPKFSISTDYSLKNILPELGIKEIFSKQ-ADLSGITGTKDLIVSQMVHKAVLDV 382

  Fly   369 DEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
            .|.|:...||| |.|...|.|    .....|..||.||.....::.||......||
Mouse   383 AETGTEGVAATGVNFRILSRR----TSLWFNRTFLMVISHTDVQTTLFIAKITHPK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 102/405 (25%)
Serpina3cXP_011242304.1 serpinA3_A1AC 56..434 CDD:381019 102/407 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.