DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpind1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001317976.1 Gene:Serpind1 / 15160 MGIID:96051 Length:478 Species:Mus musculus


Alignment Length:415 Identity:116/415 - (27%)
Similarity:195/415 - (46%) Gaps:66/415 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QRLNLYKGQQNFAVSMLNVIR-QSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHL-DW 94
            ||||:...:  ||.::..|:: |:|.::|:|.:|.....|:.:...|..|:|.:|:..|||. |:
Mouse   103 QRLNILNAK--FAFNLYRVLKDQATTSDNLFIAPVGISTAMGMISLGLRGETHEEVHSVLHFRDF 165

  Fly    95 --ADSKEVVRS-----------------AYILEKMNRKERQSKMPL--EFSSADRIFFANDLHVT 138
              |.||..|.:                 .|.|..:|....|.:.|:  :|.:|.|.|:       
Mouse   166 VNASSKYEVTTIHNLFRKLTHRLFRRNFGYTLRSVNGLYIQKQFPIREDFKAAMREFY------- 223

  Fly   139 ECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQ 203
                   ..|.|:.:|......|:  .|:.|.|.|...|:..|  :.|.|.|::::.|..|.||.
Mouse   224 -------FAEAQEANFPDPAFISK--ANNHILKLTKGLIKEAL--ENIDPATQMLILNCIYFKGT 277

  Fly   204 WLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSP 268
            |:::|..|.|....|..:......|||||.||.||...|::|...:|||.|              
Mouse   278 WVNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEY-------------- 328

  Fly   269 DENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAK 333
              ...|||::::|. ..:.::.:.::|....::...|....|..||.||||:.|:...|..:|..
Mouse   329 --VGGISMLIVVPR-KLSGMKTLEAQLTPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKS 390

  Fly   334 MGVSKMFDESVATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVL-FTYRSARPVEPAKFEC 397
            ||::|:|::: .....::.:.|:|...||.:.|.|:|||:.|||.|.: |...|.:    .:|..
Mouse   391 MGITKLFNKN-GNMSGISDQRIAIDLFKHQSTITVNEEGTQAAAVTTVGFMPLSTQ----VRFTV 450

  Fly   398 NHPFLFVIYDRTSRSILFTGIYRDP 422
            :.||||::|:..:..:||.|...:|
Mouse   451 DRPFLFLVYEHRTSCLLFMGKVTNP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 111/403 (28%)
Serpind1NP_001317976.1 HCII 43..476 CDD:239002 116/415 (28%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 54..78
Glycosaminoglycan-binding site. /evidence=ECO:0000250 171..191 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.