DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINA12

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:453 Identity:113/453 - (24%)
Similarity:197/453 - (43%) Gaps:93/453 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AIALAGLCGVEPDAGLL------------------DQRL---NLYKGQQNFAVSMLNVIRQSTPN 57
            ||.||.|..|:   |||                  .||:   .|.:...:....:|..:....|.
Human     8 AIFLAVLLTVK---GLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPG 69

  Fly    58 ENVFFSPYSTYHALLLAYFGSSGDT--------------EKELAKVLHLDWADSKEVVRSAYILE 108
            .|:|.||.|...|..:...|:...|              ||:|.:..|             ||:.
Human    70 RNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFH-------------YIIH 121

  Fly   109 KMNRKERQSKMPLEFSSADRIFFANDLH----VTECARNRLAEEVQQIDFKSQTEESRKQINDWI 169
            ::.:|.:.    |:.|..:.:|....|.    ..|.|:|..:.|....:|:: .|.::|||||:|
Human   122 ELTQKTQD----LKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQN-LEMAQKQINDFI 181

  Fly   170 AKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQK 234
            :::||.:|.|::  :.|.|.|.::|||..:.:.:|..:|....|....|:...::...|.||.:.
Human   182 SQKTHGKINNLI--ENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRS 244

  Fly   235 GTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADS 299
            |.:.:..|::|...:|::||:                .:|:.:.|||  :...|:.:...|..|:
Human   245 GIYQVGYDDKLSCTILEIPYQ----------------KNITAIFILP--DEGKLKHLEKGLQVDT 291

  Fly   300 LDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTS----ETISIGDS 360
            ..........|.::||:|:.......:|...|:.:||||:|:|    ..|||.    .::.:|::
Human   292 FSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEE----HGDLTKIAPHRSLKVGEA 352

  Fly   361 KHVAKIKVDEEGSTAAAATVLFTYRSARPVE-PAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            .|.|::|:||.|:..||.|...|.    |:| |...:.:.|:|.:||.....|:||.|...:|
Human   353 VHKAELKMDERGTEGAAGTGAQTL----PMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 100/402 (25%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 103/416 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.