DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinh1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:441 Identity:96/441 - (21%)
Similarity:172/441 - (39%) Gaps:50/441 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHILSISLMAVLPAIALAG-----LCGVEPDAG--LLDQRLNLYKGQQNFAVSMLNVIRQSTPNE 58
            |..|.:..:.:| |:|||.     |....|...  |..:...|.:.....|.|:...:.:....|
Mouse     1 MRSLLLGTLCLL-AVALAAEVKKPLEAAAPGTAEKLSSKATTLAERSTGLAFSLYQAMAKDQAVE 64

  Fly    59 NVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-------VRSAYILEKMNRKERQ 116
            |:..||.....:|.|...|....|..:...||..:....:||       :||   |.....:...
Mouse    65 NILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLGELLRS---LSNSTARNVT 126

  Fly   117 SKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNML 181
            .|:.........:.||:|.  ...::.....|..:|:|:.: ..:.:.||:|.::.|..::..:.
Mouse   127 WKLGSRLYGPSSVSFADDF--VRSSKQHYNCEHSKINFRDK-RSALQSINEWASQTTDGKLPEVT 188

  Fly   182 SADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLR 246
            ...|.|....||  ||.:.|..|..:|..:......|..:.|....|:||.:.|.:....||:.:
Mouse   189 KDVERTDGALLV--NAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYYDDEKEK 251

  Fly   247 AHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPRE 311
            ..::::|..                ..:|.::||.|.:...||.:...|..:.|...:.:...:.
Mouse   252 LQMVEMPLA----------------HKLSSLIILMPHHVEPLERLEKLLTKEQLKAWMGKMQKKA 300

  Fly   312 IEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVAKIKVDEEGSTA 375
            :.:||||...|...:|...||.:|:::..|::.|....:: .:.:.:....|....:.|.||:. 
Mouse   301 VAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWDTEGNP- 364

  Fly   376 AAATVLF---TYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
                  |   .|.......|..|..:|||:|::.|..|.|:||.|....||
Mouse   365 ------FDQDIYGREELRSPKLFYADHPFIFLVRDNQSGSLLFIGRLVRPK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 83/390 (21%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 87/406 (21%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.