DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina6

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:410 Identity:98/410 - (23%)
Similarity:175/410 - (42%) Gaps:69/410 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LDQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEK------ELAK 88
            :|...||||     .:..||      .::|...||.|...||.:....:.|.|:.      .::|
Mouse    39 VDFAFNLYK-----RLVALN------SDKNTLISPVSISMALAMLSLSTRGSTQYLENLGFNMSK 92

  Fly    89 VLHLDWADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTEC----ARNRLAEEV 149
            :       |:..:...:  :.:|...:||...||.:..:.:|...:|.:.:.    .::....|.
Mouse    93 M-------SEAEIHQGF--QYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEA 148

  Fly   150 QQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTV 214
            ..|..|..| ::.:|||:.:..:|..:|.:::|  ::.....|:|.|..:|||.|...|..|.|.
Mouse   149 LTIPSKDWT-KAGEQINNHVKNKTQGKIEHVVS--DLDSSATLILINYIFLKGIWKLPFSPENTR 210

  Fly   215 PMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPY---RTVFESQEKEDSSPDENSDISM 276
            ...||.:.::...|.||.|.|......|..:...::|:.|   .|.|                  
Mouse   211 EEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTF------------------ 257

  Fly   277 VLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFD 341
             :|||  :...::.|::.||.|::|...|..:||::.:.:|||......:|..:||.:|:..:|.
Mouse   258 -IILP--DQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFT 319

  Fly   342 ESVATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPV----EPAKFECNHPFL 402
            .. :.|.|.|.:|.......|.|.:::| ||:...|||      :..||    |....:.|.||:
Mouse   320 NQ-SDFADTTKDTPLTLTVLHKAMLQLD-EGNVLPAAT------NGPPVHLPSESFTLKYNRPFI 376

  Fly   403 FVIYDRTSRSILFTGIYRDP 422
            |:.:|:.:.|.|......:|
Mouse   377 FLAFDKYTWSSLMMSQVMNP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 92/396 (23%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 96/404 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.