DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and LOC100909605

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:444 Identity:123/444 - (27%)
Similarity:199/444 - (44%) Gaps:76/444 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LCGVEP-DAGLLDQRLN----LYKGQQN---------------FAVSMLNVIRQSTPNENVFFSP 64
            :.|:.| |.|..|.:|.    :.|||.|               ||.|:...:....|::|:.||.
  Rat     1 MAGISPADLGCPDGKLGRDTAVQKGQDNKIQVDSSTLSSCNTDFAFSLYKELVLKNPDKNIVFSS 65

  Fly    65 YSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-VRSAY--ILEKMNRKERQSKMPLEFSSA 126
            :|...||:|...|:..:|.||:.:.|..:..::.|. :...|  :|:::|....|    ::.|:.
  Rat    66 FSISTALVLLSLGAKNNTLKEILEGLKFNLTETPEAEIHQGYEHLLQRLNLPGDQ----VQISTG 126

  Fly   127 DRIFFANDLHV----TECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEIT 187
            ..:|....|.:    .|.||.....|....||: |..|::|.|||::.|||..:|:.::|.  :.
  Rat   127 SALFIKKHLQILAEFQEKARALYQAEAFSTDFQ-QPHEAKKLINDYVRKQTQGKIKELISV--LD 188

  Fly   188 PRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQ-QKGTFLLNVDEQLRAHVLQ 251
            .:|.:||.|..|.||:|...|....|....||........|.||: :|.|.....||:|...||:
  Rat   189 KKTSMVLVNYIYFKGKWKMPFDPHDTFQSEFYLDEKKSVKVPMMKIEKLTTPYFRDEELSCSVLE 253

  Fly   252 LPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSL---DDSLKQAMPREI- 312
            |.|                ..:.|.:.|||  :...::.|.:.|..::|   .|:|:   ||.| 
  Rat   254 LKY----------------TGNASALFILP--DQGRMQQVEASLQPETLRRWKDTLR---PRRID 297

  Fly   313 EVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVAKIKVDEEGSTAA 376
            |:.:|||.....:.|..||.::|:.::|.:. |....:| ::.:|:....|.|.:.|.|.|:.||
  Rat   298 ELRMPKFSISTDMRLGDILPELGIREVFSQQ-ADLSRITGAKDLSVSQVVHKAVLDVTETGTEAA 361

  Fly   377 AATVLFTYRSARPVEP--AKF-----ECNHPFLFVIYDRTSRSILFTGIYRDPK 423
            |||.:       .:.|  |||     ..|.|||.:|.|..:...||.....:||
  Rat   362 AATGV-------KIIPMCAKFYYVTMYFNRPFLMIISDTNTHIALFMAKVTNPK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 114/414 (28%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 111/398 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.