DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpinb11

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_002936466.1 Gene:serpinb11 / 100490487 XenbaseID:XB-GENE-6039640 Length:401 Species:Xenopus tropicalis


Alignment Length:420 Identity:117/420 - (27%)
Similarity:189/420 - (45%) Gaps:53/420 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKE 99
            ::.|....|::.:...:..|..|:|:||||.|...||.|.:.||..||..::.||:.......:.
 Frog     3 SINKSINEFSLDIFKELNSSCENKNIFFSPMSISAALYLLHLGSREDTATQIQKVVRYPDVKKEG 67

  Fly   100 VVRSAYILEKMNRKERQSKMPLE---FSSADRIF-----------------FANDL--------- 135
            ..|.....::.:.:|...|...|   .|.|...|                 .||.:         
 Frog    68 FFRRRCATQQRSNEESPGKDVSECGKVSDAHSKFHALLSKLTEDPKGVELQIANGMFAQMNFPFL 132

  Fly   136 -HVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAY 199
             ...|||:.....::|.:||  :.:|:|:.||.|:..:|..:|:::...:.:..||.|||.||.|
 Frog   133 QQYLECAQALYNAKLQNVDF--EKDETRENINSWVESKTQGKIKDLFEKNSLDKRTALVLVNAIY 195

  Fly   200 LKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKE 264
            .||.|.:.|:...|...|||.|......|.||.|...|.|...::|.|.:|:|||:.        
 Frog   196 FKGIWSNPFQEVHTKDAPFYVSKDVVKSVPMMYQSQKFNLGAIKELNAQILELPYQL-------- 252

  Fly   265 DSSPDENSDISMVLILPPFNSN-SLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELN 328
                   ..:||.::|.  |.. .|:.:..:|:.:.|...:......:::|.:|:|..|:.|:|.
 Frog   253 -------GALSMFILLT--NEKFGLQKIEQQLSWNYLAKGMSNMENTKLDVYIPRFRLEESLDLG 308

  Fly   329 PILAKMGVSKMFDESVATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEP 392
            ..|..||:...|.|:.|....::...:.:....|.|.::|:|||:.||||| |....:.|  |.|
 Frog   309 SHLINMGMVDAFSEAKANLSGISDVPLYVSKIVHKAFVEVNEEGTVAAAATGVQIAPKMA--VIP 371

  Fly   393 AKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            ..|:.:|.|||.|.|..:.:|||.|.|..|
 Frog   372 RVFKADHSFLFFIKDNPNDTILFFGKYESP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 114/411 (28%)
serpinb11XP_002936466.1 serpinB 7..398 CDD:381072 114/411 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.