DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpinb4

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_002936465.2 Gene:serpinb4 / 100490314 XenbaseID:XB-GENE-5787878 Length:392 Species:Xenopus tropicalis


Alignment Length:412 Identity:115/412 - (27%)
Similarity:199/412 - (48%) Gaps:46/412 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWA---- 95
            :|.|....|::.:...::::...:|:.|||.|...|:.|...||.|||..|:.||.|...|    
 Frog     3 SLSKSFSEFSLDLCKELKKNPEKKNILFSPLSICSAMGLVLLGSKGDTAAEIEKVFHFPAAAGSR 67

  Fly    96 DSKE-------VVRSAYILEK-----MNRKERQSKMPLEFSSADRIFFANDLHVTE----CARNR 144
            .||.       ..:..::|.|     :|:....    .|.|.|:|.:.......:|    |....
 Frog    68 SSKPSCQQQTCQAQGVHLLFKDLFSTLNKPNDH----YELSIANRAYGEKSFPFSEQYLLCIEQL 128

  Fly   145 LAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFK 209
            ....::.:|||::.::..:|||.|:..:|..:|:|:.:...:...|.|.|.||.|.||.|..|||
 Frog   129 YNATLESVDFKTKADDVIQQINAWVESKTKGKIQNLFAKGSLDSTTALALVNAVYFKGSWKKQFK 193

  Fly   210 TEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDI 274
            .|.|...||:.:.::.:.|.||.|||.:.|..:.:|:..:|:|||...|                
 Frog   194 KENTTDAPFFLNKNDKTSVKMMSQKGKYKLGSNPELKCRILKLPYEEGF---------------- 242

  Fly   275 SMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIE--VSLPKFEFEQRLELNPILAKMGVS 337
            ||.:|||. :.:.|.::.:.|..::....:.....||::  |.||:|:|.:...|..:|..||::
 Frog   243 SMKIILPD-DIDGLAELETHLTYETFTKLMDLQRTREVQVVVKLPQFKFGETYSLTEVLQSMGMT 306

  Fly   338 KMFDESVATFDDLTSET-ISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPF 401
            ..|..  |....::.:. ::|....|.:.|:|:|||:.|||||.:....::.|:.|.:|..:.||
 Frog   307 SAFHG--ANLSGISDKAGLAISTVVHKSYIEVNEEGTEAAAATGIGITVTSAPLPPQEFIVDRPF 369

  Fly   402 LFVIYDRTSRSILFTGIYRDPK 423
            ||.|...:::|:||.|.:..|:
 Frog   370 LFCIEHISTKSLLFYGRFTFPE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 112/402 (28%)
serpinb4XP_002936465.2 serpinB 10..387 CDD:381072 112/399 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.