DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpina10b

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:437 Identity:122/437 - (27%)
Similarity:203/437 - (46%) Gaps:75/437 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLPAIALAGLCGVE------PDAGLL-----DQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFSP 64
            :|..|:...||..|      ||...|     |..:|||:     .:|.|:       :.||.|||
Zfish     6 LLVFISACFLCSAEHEELRTPDISDLAFRNTDFAINLYR-----KISSLH-------DRNVVFSP 58

  Fly    65 YST---YHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMNRKERQSKMPLEFSSA 126
            .|.   :.|||||   :.|.|..|:.|.|:|:..|..:..|...:.:::::     .:.|:....
Zfish    59 LSVSTCFSALLLA---AQGSTRTEILKGLNLEALDGGDSRRVPELFQQLHQ-----NISLQMEQG 115

  Fly   127 DRIFFANDLHV----TECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEIT 187
            ..:|.....|:    ::..:.....||.::|| |:....|..||::::::|..::..||  :.:.
Zfish   116 TALFLDQHFHLQTNFSQQIQRFFNAEVLRVDF-SKPAVCRSLINEFVSRKTGRKVLEML--ESVE 177

  Fly   188 PRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQL 252
            |.|:::|.|..:.||.|...|....|....||....|...|.||..:..|.:..|..|||.||:|
Zfish   178 PLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNIVQVPMMMLEEKFSVVEDRDLRARVLRL 242

  Fly   253 PYRTVFESQEKEDSSPDENSDISMVLILPPFNSN--SLEDVLSRLNADSLDDSLKQAMPREIEVS 315
            |||                ...||:::||..:::  ::||.:|   |:.|...:|.....::||.
Zfish   243 PYR----------------GGASMLILLPSADADYTAIEDEIS---AERLHGWIKNMRRMKMEVH 288

  Fly   316 LPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSET----ISIGDSKHVAKIKVDEEGSTAA 376
            ||:|..:|...::.:|.::|:|.:|.:|.    |||..:    :.:....|.|.|:|.|:|::||
Zfish   289 LPRFRMDQSYHMHELLPQLGISSVFQDSA----DLTGLSRDAHLKVSQVLHKAVIEVYEQGTSAA 349

  Fly   377 AAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            ::| |..|..|.    |..|..|.||.|.:|...:.|:||.|...||
Zfish   350 SSTSVGITAYSL----PDTFIINRPFFFFLYHEETASLLFMGRVIDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 108/393 (27%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 112/406 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.