DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpinb6c

DIOPT Version :10

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_683744.2 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:184 Identity:34/184 - (18%)
Similarity:58/184 - (31%) Gaps:59/184 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LRKHPECIKKGRLIDMSDIVSDPVVQFHHKNFVLMKL-------------LFCFILPTFIPWYFF 266
            |.||.....|.:...:.:  :|..|....::|..:.|             :|.|:.|..      
Mouse   145 LEKHLNLSSKKKESQLQE--ADSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLL------ 201

  Fly   267 GETFLMSFFSQCFVRYVLSLNF----TWLV----NSAAHLYGNHPYDKRI------NPAENRAVS 317
              .||...|:.....|.|:.:|    |.|.    |:.....|.....:.:      ||.|::.:|
Mouse   202 --AFLQGLFTFYHHGYELAKDFGDFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTIS 264

  Fly   318 VVAM------------GEGWHNYHHVF----------PWDYKAAELGNYSVNVT 349
            ...|            |..|..::..:          |:|.|:...|....:||
Mouse   265 PYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 serpin42Da-like 15..368 CDD:381065 34/184 (18%)
Serpinb6cNP_683744.2 serpin 2..379 CDD:476815 34/184 (18%)

Return to query results.
Submit another query.