DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpinb9g

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_035585.2 Gene:Serpinb9g / 93806 MGIID:1919260 Length:377 Species:Mus musculus


Alignment Length:385 Identity:128/385 - (33%)
Similarity:203/385 - (52%) Gaps:38/385 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVA 73
            ::....|...|.::|......:||.:||.||.:.:|:...|::|:||.:|.:|||.  |...:|.
Mouse     5 SQANGTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHL--NPDEDVH 67

  Fly    74 QTFQFVLEKYRNSN----LLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFA-LNDAAAQA 133
            |.||.:|......|    .|.:||:|:|:...:|.|.::.:..:.||||.|.::|| ..:.:.|.
Mouse    68 QGFQLLLHNLNKQNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEESRQH 132

  Fly   134 INAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKIN 198
            ||.||:.:|.|||.:|:|.||.:..|||:|.|||:|.|:|..:|.:.||:|..|.:.::|...:.
Mouse   133 INMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQ 197

  Fly   199 YMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTV- 262
            .|.::....:.:.:::....|.|||:..||:..||||.|...|..:...|       ..:|||. 
Mouse   198 MMWREDTLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNL-------TFEKLTAW 255

  Fly   263 --------EEVHVKFPKFKVDYSLELAEKLKQLGITKMFT-DQAEFSNLLESPEGVFVSKVLHKA 318
                    .|.||..|||::....::...|:.|||..:|. .:|:.|. :.:.|.:.:|:..||.
Mouse   256 TKPEFMNRTEFHVYLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSG-MSTKENLCLSEFAHKC 319

  Fly   319 TIEVNEEGTEAAAATGMIMMTRMMTF------PLQFQADRPFLYVIWNK--KNILFAGAF 370
            .:||||||||||||:.:     ...|      |..|.||.|||:.|.::  .:|||.|.|
Mouse   320 VVEVNEEGTEAAAASAV-----KFIFLCSGPDPETFCADHPFLFFIMHRTTNSILFCGRF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 127/379 (34%)
Serpinb9gNP_035585.2 SERPIN 4..377 CDD:294093 128/385 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.