DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and AT1G64010

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001320592.1 Gene:AT1G64010 / 842704 AraportID:AT1G64010 Length:199 Species:Arabidopsis thaliana


Alignment Length:219 Identity:61/219 - (27%)
Similarity:100/219 - (45%) Gaps:46/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPYQDS----- 226
            ::|||:|..||.:..|::..|.:.....|.::.|: ..|..|....| |...|::|::..     
plant     1 MYFKGAWEEKFHKSMTKDRDFHLINGTSVSVSLMS-SYKDQYIEAYD-GFKVLKLPFRQGNDTSR 63

  Fly   227 DLSMFVLLPQERTGIYALAEKL-KTVNLVDL---ADKLTVEEVHVKFPKFKVDYSLELAEKLKQL 287
            :.||...||.|:.|:..|.||: .:|..:|.   :.|:.|.|..:  ||||:::....:....:|
plant    64 NFSMHFYLPDEKDGLDNLVEKMASSVGFLDSHIPSQKVKVGEFGI--PKFKIEFGFSASRAFNRL 126

  Fly   288 GITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAAAAT------GMIMMTRMMTFPL 346
            |:.:|                    .:..||.:|::|||.||.|||      |...:.|     :
plant   127 GLDEM--------------------ALYQKACVEIDEEGAEAIAATAVVGGFGCAFVKR-----I 166

  Fly   347 QFQADRPFLYVIWNKK--NILFAG 368
            .|.||.|||::|...|  .:||.|
plant   167 DFVADHPFLFMIREDKTGTVLFVG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 61/219 (28%)
AT1G64010NP_001320592.1 serpin <1..195 CDD:393296 61/219 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.