DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpind1

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:386 Identity:112/386 - (29%)
Similarity:196/386 - (50%) Gaps:43/386 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARFTSELFQLL-SAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVAQTF 76
            |:|...|:::| ......:|:..:|..|.|.:.:...|.:|||.:|:...|||         :.|
  Rat   111 AKFAFNLYRVLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHF---------KDF 166

  Fly    77 QFVLEKYRNSNL-------------------LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESI 122
            .....||..:.:                   |:..|.||:|:...::..:::|::|.|.:||:..
  Rat   167 VNASSKYEVTTIHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQEA 231

  Fly   123 NFALNDAAAQAINAWVNAKTQGKITE-LVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDI 186
            :|: :.|.....|:.:...|:|.|.| |.:.||   .|::::||.::|||:|.:||..|.|....
  Rat   232 DFS-DPAFISKANSHILKLTKGLIKEALENTDS---ATQMMILNCIYFKGAWMNKFPVEMTHNHN 292

  Fly   187 FWVGEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTV 251
            |.:.|.|.||::.|..|..|.....::|.|..|::.|. ..:||.:::|::.:|:..|..:| |.
  Rat   293 FRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIVIPRKLSGMKTLEAQL-TP 355

  Fly   252 NLVDLADK-LTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVL 315
            .:|:...| :|.....|..||||::.:..|.|.||.:||||:|......|.:  |.:.:.:....
  Rat   356 QVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGI--SDQRIIIDLFK 418

  Fly   316 HKATIEVNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAGAFVKAA 374
            |::||.||||||:|||.|.:..|.  ::..::|..|||||::::..:.  :||.|.....|
  Rat   419 HQSTITVNEEGTQAAAVTTVGFMP--LSTQVRFTVDRPFLFLVYEHRTSCLLFMGRVANPA 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 111/380 (29%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 111/384 (29%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.