DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina9

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:367 Identity:113/367 - (30%)
Similarity:193/367 - (52%) Gaps:20/367 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNF----PPEVAQ 74
            ||:..|:|.|:.....:|::|||.||.|.:|:...|::..|..:|.:.|.|  ||    .|.:..
Mouse    52 RFSFLLYQRLAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGF--NFTWVSEPTIHM 114

  Fly    75 TFQFV---LEKYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQA-IN 135
            .|:::   |.|......||:.:.|::::..||:..:...:|:.|.::..|.:|: |.|.||| ||
Mouse   115 GFEYLVRSLNKCHQGRELRMGSVLFIRKELQLQATFLDRVKKLYGAKVFSEDFS-NAATAQAQIN 178

  Fly   136 AWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDI-FWVGEEEQVKINY 199
            ::|..:|:||:.:::  ......|.:||:|.:.||.:|...||...|.:.. |.:.:...|.:..
Mouse   179 SYVEKETKGKVVDVI--QDLDSQTAMVLVNHIFFKANWTQPFSTANTNKSFPFLLSKGTTVHVPM 241

  Fly   200 MNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTVEE 264
            |:|...|.:|..::|||:.|:|.|:...::.|||..:.:  :..|.:.|....|...:..|....
Mouse   242 MHQTESFAFGVDKELGCSILQMDYRGDAVAFFVLPGKGK--MRQLEKSLSARRLRKWSRSLQKRW 304

  Fly   265 VHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEA 329
            :.|..|||.:..|..|...|.::||...|...|:||.:.:: ..:.|||..|||.::|:||||||
Mouse   305 IKVFIPKFSISASYNLETILPKMGIRDAFNSNADFSGITKT-HFLQVSKAAHKAVLDVSEEGTEA 368

  Fly   330 AAATGMIMMTRMMTFPLQFQA-DRPFLYVIWNK--KNILFAG 368
            ||||...::.|....|....| ..|||.::.:|  :::||.|
Mouse   369 AAATTTKLIVRSRDTPSSIIAFKEPFLILLLDKNTESVLFLG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 113/367 (31%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 113/367 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.