DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina1f

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:369 Identity:85/369 - (23%)
Similarity:162/369 - (43%) Gaps:43/369 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPP--EVAQTFQFVLEKYRN 85
            ||..|   |::|||..:...|::...||.|..:..|.:.|.|.....|  |:.:.|.::|.....
Mouse    62 LSGNG---NILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNKTGLPEAEIHKCFWYLLHSIHQ 123

  Fly    86 S---NLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAWVNAKTQGKIT 147
            :   :.|:..:.:::.:.......:...:|:.|||:..||||..:..|...||.:|..|:|.:|.
Mouse   124 TEEPSSLQTGSSVFIHQDLTSVDKFVKGVKDLYHSDMISINFTDSSQAKTQINNYVMEKSQKEIV 188

  Fly   148 ELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQKAKFNYGF-F 211
            .:|.  :...:|.|.::|.:.:.......|.....:...:.:|....:|:..::..| .:|.| .
Mouse   189 NIVK--NLESDTFLAVVNYIIWNAKLDSNFGCRSVKVKDYHLGYGMTIKVPMIHNMA-MHYLFRV 250

  Fly   212 EDLGCTALEMPYQDSDLSMFVLLPQ-------ERTGIYALAEKLKTVNLVDLADKLTVEEVHVKF 269
            |||..|.|.:.....:.:.:.::|.       |::..|....:::...|..|.|        ::.
Mouse   251 EDLSSTVLMLTLLTGNFATYFIIPDPGKMQKVEQSLTYPHFRRMRRQLLTRLVD--------LEI 307

  Fly   270 PKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAAAAT- 333
            |:..:..:.:|...:..||||.:|......|::.::.:..|  ||:.||.:.::|:|::.:..: 
Mouse   308 PELSLSETHDLESMMSLLGITYVFNSGTNSSDMNDTLQKSF--KVVSKAVLTIDEKGSKPSTNSC 370

  Fly   334 ----GMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAGAFV 371
                |...|.||       |.:||||..|.:..|  .||.|..|
Mouse   371 FKKLGSTDMGRM-------QLNRPFLIFIQDHTNDVPLFLGRVV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 84/366 (23%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 85/369 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.